DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16775 and AgaP_AGAP009606

DIOPT Version :9

Sequence 1:NP_649022.2 Gene:CG16775 / 39993 FlyBaseID:FBgn0036767 Length:191 Species:Drosophila melanogaster
Sequence 2:XP_318634.4 Gene:AgaP_AGAP009606 / 1278979 VectorBaseID:AGAP009606 Length:297 Species:Anopheles gambiae


Alignment Length:163 Identity:40/163 - (24%)
Similarity:70/163 - (42%) Gaps:25/163 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 KWVYLDKTLDLPEEAILGGVDPDGYYTYVGRVTYSSNILPARVVPELGKATYNTDTLGNQATTYE 95
            :||...:.: :|.||::.|.  :|..||:||..:...|:|.||:|........::.|.:....|:
Mosquito     4 RWVLAAEGV-VPPEAVVAGY--EGETTYIGRAKHRKAIVPGRVIPSKKACLIVSEGLEHAVHDYQ 65

  Fly    96 VLVSNATVGY--HWIRSFDGFREKNAVSVGTNALSERVFICRVRCDESIFIGTLYLSKRMCIVKY 158
            ||     .||  .::::..|:....::..|.....:.:||..||......:|:: :....|....
Mosquito    66 VL-----CGYDGRFVQTSGGYCPIGSLQGGVTKRGKPIFIGLVRMGLVTVVGSI-VPDEFCCQAV 124

  Fly   159 DNFPLRQFDKYEILVRERHVAAVSPFVDGYIHH 191
            .|..||:|:.|||.              ||..|
Mosquito   125 VNGILRRFNDYEIF--------------GYTEH 143

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16775NP_649022.2 DM9 29..100 CDD:128937 20/68 (29%)
DUF3421 51..164 CDD:288732 25/114 (22%)
DM9 104..175 CDD:128937 17/72 (24%)
AgaP_AGAP009606XP_318634.4 DM9 5..70 CDD:128937 20/72 (28%)
DUF3421 22..127 CDD:288732 24/112 (21%)
DM9 151..216 CDD:128937
DUF3421 168..275 CDD:288732
DM9 217..285 CDD:128937
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
21.870

Return to query results.
Submit another query.