DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16775 and AgaP_AGAP006398

DIOPT Version :9

Sequence 1:NP_649022.2 Gene:CG16775 / 39993 FlyBaseID:FBgn0036767 Length:191 Species:Drosophila melanogaster
Sequence 2:XP_316431.3 Gene:AgaP_AGAP006398 / 1277009 VectorBaseID:AGAP006398 Length:290 Species:Anopheles gambiae


Alignment Length:157 Identity:43/157 - (27%)
Similarity:73/157 - (46%) Gaps:9/157 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 WVYLDKTLDLPEEAILGGVDPDGYYTYVGRVTYSSNILPARVVPELGKATYNTDTLGNQATTYEV 96
            |:.......:|..|:.||.|.||...|:||..:..:.|||:|:|....|..:.:.:....|.:||
Mosquito     7 WIPWTSHQGIPPAAVYGGNDQDGSPIYIGRAYHEGDQLPAKVIPSKQAAYVSHNGMEIFKTHFEV 71

  Fly    97 LVSNATVGYHWIRSFDGFREKNAVSVGTNALSERVFICRVRCDESIFIGTLYLSKRMCIVKYDNF 161
            |..   .|:.|:.|.:|....|||..|.....|:::|.|...:.|:..|.::.|.....:.:...
Mosquito    72 LTG---TGFTWVSSGNGHVPANAVLAGNTTTGEQLYIGRTHHEGSLTPGKIHRSHGCLYIPFGGA 133

  Fly   162 PLRQFDKYEILVRE-----RHVAAVSP 183
            . :.|..||:||.:     :|.:|.:|
Mosquito   134 E-QSFLSYEVLVGQQRSNWQHCSAHAP 159

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16775NP_649022.2 DM9 29..100 CDD:128937 21/67 (31%)
DUF3421 51..164 CDD:288732 30/112 (27%)
DM9 104..175 CDD:128937 19/70 (27%)
AgaP_AGAP006398XP_316431.3 DM9 4..75 CDD:128937 21/70 (30%)
DUF3421 26..136 CDD:288732 30/113 (27%)
DM9 76..146 CDD:128937 19/70 (27%)
DM9 151..219 CDD:128937 3/9 (33%)
DUF3421 170..279 CDD:288732
DM9 222..288 CDD:128937
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005929
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR31649
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.