DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5506 and nopo

DIOPT Version :9

Sequence 1:NP_649021.1 Gene:CG5506 / 39992 FlyBaseID:FBgn0036766 Length:180 Species:Drosophila melanogaster
Sequence 2:NP_611305.1 Gene:nopo / 37083 FlyBaseID:FBgn0034314 Length:435 Species:Drosophila melanogaster


Alignment Length:172 Identity:36/172 - (20%)
Similarity:58/172 - (33%) Gaps:44/172 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MYKLVCVVLA-LFAVAYAVPSTYDTEHVWKAGNLSYVIPYNAVVGGFDPYGFTTYVGRVKYSNSI 64
            |..|.||:.| ||..|..|                                |.|..|.:.:.|.:
  Fly     1 MLNLNCVICAELFGQADEV--------------------------------FATVCGHMFHHNCL 33

  Fly    65 LPARVVAETGTAYFNTETTSSKLLVYDILVAERDVNYVWVRSFDGFYEKGAVAVGTTVKNERVFC 129
            ......::|.....|..||.:...|| ..:|..||:::.|.|.....:...:::....|.     
  Fly    34 NQWLDRSKTCPQCRNKCTTRNIFRVY-FNLANLDVSHIDVGSLQEQLDNAMLSMKMVEKE----- 92

  Fly   130 CRAKTDGGILIGTLLLSSQKVCIIKHESLALRKFDKYEVLVA 171
             |.|.:..|   ..|..:||.|:.....|. :|..|.:.|::
  Fly    93 -RNKDEQQI---RDLKETQKKCLKTIAGLE-QKVQKKDFLIS 129

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5506NP_649021.1 DM9 25..96 CDD:128937 10/70 (14%)
DUF3421 47..161 CDD:288732 24/113 (21%)
DM9 100..172 CDD:128937 14/72 (19%)
nopoNP_611305.1 zf-RING_2 5..47 CDD:290367 12/73 (16%)
zf-rbx1 <5..47 CDD:289448 12/73 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.