DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7408 and Sgsh

DIOPT Version :9

Sequence 1:NP_001163462.1 Gene:CG7408 / 39991 FlyBaseID:FBgn0036765 Length:585 Species:Drosophila melanogaster
Sequence 2:NP_650760.1 Gene:Sgsh / 42266 FlyBaseID:FBgn0038660 Length:524 Species:Drosophila melanogaster


Alignment Length:587 Identity:130/587 - (22%)
Similarity:220/587 - (37%) Gaps:178/587 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 NIIIIMADDLGFDDVSFRGSNNFL-TPNIDALAYSGVILNNLYVA-PMCTPSRAALLTGK----- 93
            |:::::|||.||:..::  .|.|. |||:||||..|::.||.:.: ..|:|||:.||||:     
  Fly    22 NVLLLLADDAGFESGAY--LNKFCQTPNLDALAKRGLLFNNAFTSVSSCSPSRSQLLTGQAGHSS 84

  Fly    94 --YPINTGMQHYVIVNDQPWGLPLNETTMAEIFR-ENGYR--TSLLGKWHLGLSQRNFTPTERGF 153
              |.::.|:.::.::.|        ..::..:.| ::|.|  :.::||.|:| :..||.     |
  Fly    85 GMYGLHQGVHNFNVLPD--------TGSLPNLIRDQSGGRILSGIIGKKHVG-AANNFR-----F 135

  Fly   154 DRHLGYLGAYVDYYTQSYEQQNKGYNGHDFRDSLKSTHDHVGHYVTDLLTDAAVKEIEDHGSKNS 218
            |            :.|:.||.:....|.:.        ..:..|....|..|          |:.
  Fly   136 D------------FEQTEEQHSINQIGRNI--------TRMKEYARQFLKQA----------KDE 170

  Fly   219 SQPLFLLLNHLAPHAA-----------------------------------NDDDPMQAPAEEVS 248
            .:|.||::....||..                                   |.|.|...|..:|.
  Fly   171 KKPFFLMVGFHDPHRCGHITPQFGEFCERWGSGEEGMGSIPDWKPIYYDWRNLDVPAWLPDTDVV 235

  Fly   249 RFEYISNKTHRYYAAMVSRLDKSVGSVIDALARQEMLQNSIILFLSDNGGPTQGQHSTTASNYPL 313
            |.|..:    :|..  :||||:.||.::..|....:...:::::.||||.|           :| 
  Fly   236 RQELAA----QYMT--ISRLDQGVGLMLKELEAAGVADQTLVIYTSDNGPP-----------FP- 282

  Fly   314 RGQKNSPWEGALRSSAAIWSTEFE-RLGSVWKQQIYIGDLLPTLAAAAGISPDPALHLDGLNLWS 377
             |.:.:.:|..:||...|.|...| |........:.:.|:.|::..|..| |.|           
  Fly   283 -GGRTNLYEHGIRSPLIISSPNKEDRHHEATAAMVSLLDIYPSVMDALQI-PRP----------- 334

  Fly   378 ALKYGYESVEREIVHVIDEDVAEPHLSYTRGKWKVISGTTNQGLYDGWLGHRETSEVDPRAVEYE 442
               ...:.|.|.|:.|:.|   ||.:.            .:..::.....|..|.....|.|...
  Fly   335 ---NDTKIVGRSILPVLRE---EPPIK------------ESDSVFGSHSYHEVTMAYPMRMVRNR 381

  Fly   443 --ELVRNTSVW--LQLQQVSFGERNISELRDQSRIECPDPATGVKPCLP--------LEGP--CL 493
              :|:.|.:.|  ..:.|..:......::.:         ||..|..||        .:.|  .|
  Fly   382 RYKLIHNINYWADFPIDQDFYTSPTFQQILN---------ATLRKQTLPWYRSLLQYYQRPEWEL 437

  Fly   494 FDIEADPCERSNL--YAEYQNSTIFLDLWSRIQQFAKQAHPPNNKPGDP-NCDPRFYHNEWTWWQ 555
            :||:.||.||.||  .|:| |.|        ::|..:|.........|| .|.|.....|...::
  Fly   438 YDIKTDPLERFNLADKAKY-NGT--------LKQLREQLFDWQVATKDPWRCAPHAVLQEQGVYK 493

  Fly   556 DE 557
            |:
  Fly   494 DQ 495

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7408NP_001163462.1 AslA 31..425 CDD:225661 95/436 (22%)
4-S 35..423 CDD:293753 95/434 (22%)
SgshNP_650760.1 AslA 17..476 CDD:225661 124/566 (22%)
SGSH 22..471 CDD:293751 124/561 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45466504
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3119
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.