DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7408 and STS

DIOPT Version :9

Sequence 1:NP_001163462.1 Gene:CG7408 / 39991 FlyBaseID:FBgn0036765 Length:585 Species:Drosophila melanogaster
Sequence 2:NP_001307679.1 Gene:STS / 412 HGNCID:11425 Length:590 Species:Homo sapiens


Alignment Length:656 Identity:154/656 - (23%)
Similarity:238/656 - (36%) Gaps:208/656 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 FVLCIALSNGIVATSDKPNIIIIMADDLGFDDVSFRGSNNFLTPNIDALAYSGV-ILNNLYVAPM 81
            |:|...|.......:.:||||::||||||..|....|:....|||||.||..|| :..:|..:|:
Human    17 FLLLFFLWEAESHAASRPNIILVMADDLGIGDPGCYGNKTIRTPNIDRLASGGVKLTQHLAASPL 81

  Fly    82 CTPSRAALLTGKYPINTGMQHY-----VIVNDQPWGLPLNETTMAEIFRENGYRTSLLGKWHLGL 141
            |||||||.:||:||:.:||..:     .:......|||.:|.|.|::.::.||.|:|:||||||:
Human    82 CTPSRAAFMTGRYPVRSGMASWSRTGVFLFTASSGGLPTDEITFAKLLKDQGYSTALIGKWHLGM 146

  Fly   142 SQRNFT-----PTERGFDRHLG------------------------------------------- 158
            |..:.|     |...||:...|                                           
Human   147 SCHSKTDFCHHPLHHGFNYFYGISLTNLRDCKPGEGSVFTTGFKRLVFLPLQIVGVTLLTLAALN 211

  Fly   159 -------------------------YLGAYVDYY-------TQSYE--QQNKGYNGHDFRDSLKS 189
                                     :|| ::.|:       .::||  ||...|:.         
Human   212 CLGLLHVPLGVFFSLLFLAALILTLFLG-FLHYFRPLNCFMMRNYEIIQQPMSYDN--------- 266

  Fly   190 THDHVGHYVTDLLTDAAVKEIEDHGSKNSSQPLFLLLNHLAPHAANDDDPMQAPAEEVSRFEYIS 254
                    :|..||..|.:.|:    :|:..|..|:|::|..|.|           ..|..::..
Human   267 --------LTQRLTVEAAQFIQ----RNTETPFLLVLSYLHVHTA-----------LFSSKDFAG 308

  Fly   255 NKTHRYYAAMVSRLDKSVGSVIDALARQEMLQNSIILFLSDNGGPTQGQHST----TASNYPLRG 315
            ...|..|...|..:|.|||.:::.|....:..:::|.|.||.|...:...|.    ..||...:|
Human   309 KSQHGVYGDAVEEMDWSVGQILNLLDELRLANDTLIYFTSDQGAHVEEVSSKGEIHGGSNGIYKG 373

  Fly   316 QKNSPWEGALRSSAAIWSTEFERLGSVWKQQIYIG----------DLLPTLAAAAGIS-PDPALH 369
            .|.:.|||.:|....:          .|.:.|..|          |:.||:|..||.. |:..: 
Human   374 GKANNWEGGIRVPGIL----------RWPRVIQAGQKIDEPTSNMDIFPTVAKLAGAPLPEDRI- 427

  Fly   370 LDGLNLWSALKYGYESVEREIVHVIDEDVAEPHLSYTRGKWKVISGTTNQGLYDGWLGHRETSEV 434
            :||.:|...|:...:..:.|.:.    .....:|:..|                 |  |.:.|  
Human   428 IDGRDLMPLLEGKSQRSDHEFLF----HYCNAYLNAVR-----------------W--HPQNS-- 467

  Fly   435 DPRAVEYEELVRNTSVWLQLQQVSFGERNISELRDQSRIECPDPATGVKPCLPL-----EGPCLF 494
                         ||:|    :..|...|.:.:......     ||.|..|...     :.|.||
Human   468 -------------TSIW----KAFFFTPNFNPVGSNGCF-----ATHVCFCFGSYVTHHDPPLLF 510

  Fly   495 DIEADPCERSNLYAEYQNSTIFLDLWSRIQQFAKQAHPPNNKPGDPNCDPRFYHNEWTW--WQDE 557
            ||..||.||:.|..  .:...|.:: .::.|.|...|....    |....:|..|.:.|  |...
Human   511 DISKDPRERNPLTP--ASEPRFYEI-LKVMQEAADRHTQTL----PEVPDQFSWNNFLWKPWLQL 568

  Fly   558 KASSSG 563
            ...|:|
Human   569 CCPSTG 574

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7408NP_001163462.1 AslA 31..425 CDD:225661 118/496 (24%)
4-S 35..423 CDD:293753 118/490 (24%)
STSNP_001307679.1 AslA 30..555 CDD:225661 145/622 (23%)
ES 33..557 CDD:293778 146/621 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165157203
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3119
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.