DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7408 and Gns

DIOPT Version :9

Sequence 1:NP_001163462.1 Gene:CG7408 / 39991 FlyBaseID:FBgn0036765 Length:585 Species:Drosophila melanogaster
Sequence 2:XP_006241458.1 Gene:Gns / 299825 RGDID:1305877 Length:544 Species:Rattus norvegicus


Alignment Length:595 Identity:136/595 - (22%)
Similarity:228/595 - (38%) Gaps:206/595 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 LLTGFVLCIALSNGIVATSDKPNIIIIMADDLGFDDVSFRGSNNFLTP--NIDAL-AYSGVILNN 75
            ||:|   |:    |:|..:.:||:::::.||   .|....|    :||  ...|| ...|:..::
  Rat    25 LLSG---CL----GLVGAARRPNVLLLLTDD---QDAELGG----MTPLKKTKALIGEKGMTFSS 75

  Fly    76 LYV-APMCTPSRAALLTGKYPINTGMQHYVIVN--------------DQPWGLPLNETTMAEIFR 125
            .|| :.:|.||||::||||||.|    |:|:.|              .:|:..|      |.:..
  Rat    76 AYVPSALCCPSRASILTGKYPHN----HHVVNNTLEGNCSSKSWQKIQEPYTFP------AILKL 130

  Fly   126 ENGYRTSLLGKWHLGLSQRNFTPTERGFDR-HLGYLGAYVDYYTQSYEQQNKGYNGHDFRDSLK- 188
            ..||:|...||:   |::.. .|...|.:. .||:      .|..:.|:.:|.||   :..|:. 
  Rat   131 VCGYQTFFAGKY---LNEYG-APDAGGLEHVPLGW------SYWYALEKNSKYYN---YTLSING 182

  Fly   189 STHDHVGHYVTDLLTDAAVK---EIEDHGSKNSSQPLFLLLNHLAPHAANDDDPMQ--------A 242
            ....|..:|..|.|||....   :..|:  |::|:|.|::::..|||:.....|..        |
  Rat   183 KARRHGENYSVDYLTDVLANLSLDFLDY--KSNSEPFFMMISTPAPHSPWTAAPQYQKAFPNVIA 245

  Fly   243 PAEE---------------------VSRFEYISNKTHRYYAAMVSRLDKSVGSVIDALARQEMLQ 286
            |..:                     .|..:::.:...|.:..::| :|..|..::..|.....|.
  Rat   246 PRNKNFNIHGTNKHWLIRQAKTPMTNSSIKFLDDAFRRRWQTLLS-VDDLVEKLVKRLDSTGELD 309

  Fly   287 NSIILFLSDNGGPTQGQHSTTASNYPLRGQKNSPWEGALRSSAAIWSTEFERLGSVWKQQIYIGD 351
            |:.|.:.||||..|              ||.:.|                     :.|:|:|..|
  Rat   310 NTYIFYTSDNGYHT--------------GQFSLP---------------------IDKRQLYEFD 339

  Fly   352 L-LPTLAAAAGISPDPALHLDGLNLWSALKYGYESVEREIVHVID-----EDVAEPHLSYTRGKW 410
            : :|.|....||.|:                   ...:.:|..||     .|:|...|:.|:   
  Rat   340 IKVPLLVRGPGIKPN-------------------QTSKMLVSNIDLGPTILDLAGYDLNKTQ--- 382

  Fly   411 KVISGTTNQGLY--DGWLGHRETSEVDPRAVEYEELVRNTSVWLQLQQVSFGE-RNISELRDQSR 472
              :.||:...:.  ||.|..|  |:|   .|||:                 || ||:::      
  Rat   383 --MDGTSLLPILKGDGNLTWR--SDV---LVEYQ-----------------GEGRNVTD------ 417

  Fly   473 IECPDPATGVKPCLPLEGPCLFDIEAD---PCERS-----NL-YAEYQNSTIFLDLWS------R 522
            ..||..:.||..|.|   .|:.:...:   .|.|:     || |.|:.:..:|:::::      :
  Rat   418 PTCPSLSPGVSQCFP---DCVCEDAYNNTYACVRTLSSMWNLQYCEFDDQEVFVEVYNITADPDQ 479

  Fly   523 IQQFAKQAHP 532
            |...||...|
  Rat   480 ITNIAKSIDP 489

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7408NP_001163462.1 AslA 31..425 CDD:225661 100/453 (22%)
4-S 35..423 CDD:293753 99/447 (22%)
GnsXP_006241458.1 G6S 38..487 CDD:293766 129/571 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166351105
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3119
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.