DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5535 and GNP1

DIOPT Version :9

Sequence 1:NP_649019.2 Gene:CG5535 / 39990 FlyBaseID:FBgn0036764 Length:630 Species:Drosophila melanogaster
Sequence 2:NP_010796.1 Gene:GNP1 / 852121 SGDID:S000002916 Length:663 Species:Saccharomyces cerevisiae


Alignment Length:473 Identity:91/473 - (19%)
Similarity:170/473 - (35%) Gaps:112/473 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 RKKPLE-DSNESKLAKVLSAFDLTALGIGSTLGVGVYVLAGEVSKQYAGP-AVVVSFLI------ 80
            ::.|.| :..:..|.|.:.......:.:|:.:|.|:.|...:|... ||| .:::.:.|      
Yeast   132 KQSPQEQEQKQENLKKSIKPRHTVMMSLGTGIGTGLLVGNSKVLNN-AGPGGLIIGYAIMGSCVY 195

  Fly    81 ------AAIASIFAGLCYAEFGARVPKAGSAYIYSYVTIGEFIAFLIGWNLILEYAIGSASVVKG 139
                  ..:|.|::.|           .|....|....:...:.|.:.|...|::          
Yeast   196 CIIQACGELAVIYSDL-----------IGGFNTYPLFLVDPALGFSVAWLFCLQW---------- 239

  Fly   140 LSTYLDQLCGNPMSSFLGTHMPLNIEGMGAYPDLFAFVVTILFSLAIAVGAKESTRVNNVFTMLN 204
                   ||..|: ..:...|.:........||:|..:..:|..:....|||.....:..|....
Yeast   240 -------LCVCPL-ELVTASMTIKYWTTSVNPDVFVVIFYVLIVVINVFGAKGYAEADFFFNCCK 296

  Fly   205 -LGVVLFVIIAGLFK---------VSSSNWSIPKSQVPEGYGDGGFMPYGVSGIIKGAAVCFYGF 259
             |.:|.|.|:|.:..         :.|..|..|.:    ..||.....:  .|::.......:.|
Yeast   297 ILMIVGFFILAIIIDCGGAGTDGYIGSKYWRDPGA----FRGDTPIQRF--KGVVATFVTAAFAF 355

  Fly   260 IGFDCIATAGEEAKNPKKSIPFA---VIVSLAMIFLAYFGVSTVLTMMLPYFEQD--------EK 313
            ...:.:|....|..||:|:||.|   :|..:..:|||..   |::..::||....        .|
Yeast   356 GMSEQLAMTASEQSNPRKAIPSAAKKMIYRILFVFLASL---TLVGFLVPYTSDQLLGAAGSATK 417

  Fly   314 APLPHVFRI--NGWHVAEYVVSIGAMFGLCSSMMGAMFPLPRIVFAMSNDGLLFKFLGDISEKYK 376
            |. |:|..:  :|..|..:.::...:..:.|...||.:...||:.:::..|...|.. |..::..
Yeast   418 AS-PYVIAVSSHGVRVVPHFINAVILLSVLSVANGAFYTSSRILMSLAKQGNAPKCF-DYIDREG 480

  Fly   377 TPFKGTMITGMLTGILA----------------AVFNLSQLVNMMSIGTLLAYSMVASCVLMLRY 425
            .| ...|:...|.|::|                |:..||||           ::.:..|:..:|:
Yeast   481 RP-AAAMLVSALFGVIAFCASSKKEEDVFTWLLAISGLSQL-----------FTWITICLSHIRF 533

  Fly   426 EVDDRRESRIVANGRATG 443
                ||..::  .||:.|
Yeast   534 ----RRAMKV--QGRSLG 545

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5535NP_649019.2 2A0303 20..585 CDD:273330 91/473 (19%)
AA_permease_C 535..585 CDD:290617
GNP1NP_010796.1 2A0310 146..626 CDD:273334 88/459 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157345722
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1286
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 90 1.000 Inparanoid score I1545
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53617
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.800

Return to query results.
Submit another query.