DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5535 and Slc7a7

DIOPT Version :9

Sequence 1:NP_649019.2 Gene:CG5535 / 39990 FlyBaseID:FBgn0036764 Length:630 Species:Drosophila melanogaster
Sequence 2:NP_112631.1 Gene:Slc7a7 / 83509 RGDID:619902 Length:512 Species:Rattus norvegicus


Alignment Length:514 Identity:117/514 - (22%)
Similarity:212/514 - (41%) Gaps:103/514 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 SNESKLAKVLSAFDLTALGIGSTLGVGVYVLAGEVSKQYA--GPAVVVSFLIAAIASIFAGLCYA 93
            :.:.||.|.:|..:...|.:|:.:|.|::|....|....|  |.::|: :.:..|.|:|..||||
  Rat    31 AEQVKLKKEISLLNGVCLIVGNMIGSGIFVSPKGVLMYSASFGLSLVI-WAVGGIFSVFGALCYA 94

  Fly    94 EFGARVPKAGSAYIYSYVTIGEFIAFLIGWN--LILEYAIGSASVVKGLSTYLDQ----LCGNPM 152
            |.|..:.|:|::|.|.....|.|:||:..|.  ||:| ....|.:....:.|:.|    .||.|.
  Rat    95 ELGTTIKKSGASYAYILEAFGGFLAFIRLWTSLLIIE-PTSQAVIAITFANYMVQPLFPSCGAPY 158

  Fly   153 SSFLGTHMPLNIEGMGAYPDLFAFVVTILFSLAIAVGAKESTRVNNVFTMLNLGVVLFVIIAGLF 217
                            |...|.|.....|.:.......|..|.|.::||...:..::.|||||:.
  Rat   159 ----------------AAGRLLAAACICLLTFINCAYVKWGTLVQDIFTYAKVLALIAVIIAGIV 207

  Fly   218 KV---SSSNWSIPKSQVPEGYGDGGFMPYGVSGIIKGAAVCFYGFIGFDCIATAGEEAKNPKKSI 279
            ::   :::|:        |...:|.....|...:...:|:  :.:.|:|.:....||.:||::::
  Rat   208 RLGQGATTNF--------EDSFEGSSFAMGDIALALYSAL--FSYSGWDTLNYVTEEIRNPERNL 262

  Fly   280 PFAVIVSLAMIFLAYFGVSTVLTMMLPYFEQDEKAPL----------PHVFRINGWHVAEYVVSI 334
            |.::.:|:.::.:.|     :||.:..|...|.|..|          ..:|.|..|.: ...|::
  Rat   263 PLSIGISMPIVTIIY-----LLTNVAYYSVLDIKDILASDAVAVTFADQIFGIFNWTI-PLAVAL 321

  Fly   335 GAMFGLCSSMMGAMFPLPRIVFAMSNDGLLFKFLGDISEKYKTPFKGTMITGMLTGILAAVFNLS 399
            ....||.:|::.|    .|::|..|.:|.|...:..|..:..||....:..|:|..:...|.::.
  Rat   322 SCFGGLNASIVAA----SRLLFVGSREGHLPDAICMIHVERFTPVPSLLFNGILALVYLCVEDIF 382

  Fly   400 QLVNMMSIG--TLLAYSMVASCVLMLRYEVDDRRESRIVANGRATGLEQDRPCALWRRIFNLNGQ 462
            ||:|..|..  ..:..|:|..  |.||::                  |.|||..|          
  Rat   383 QLINYYSFSYWFFVGLSIVGQ--LYLRWK------------------EPDRPRPL---------- 417

  Fly   463 TVPTKQTSRIVTYSVTLFSLWCMVFSQILTKFEEDLANVTSFDGIKLVLGTIPLAVLLL 521
                    ::..:...:|.| |.:|...:..:.:   .:.|..||.:.|..:|...|::
  Rat   418 --------KLSLFFPIVFCL-CTIFLVAVPLYSD---TINSLIGIGIALSGLPFYFLII 464

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5535NP_649019.2 2A0303 20..585 CDD:273330 117/514 (23%)
AA_permease_C 535..585 CDD:290617
Slc7a7NP_112631.1 2A0308 24..496 CDD:273332 117/514 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166351182
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53617
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.850

Return to query results.
Submit another query.