DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5535 and LOC688389

DIOPT Version :9

Sequence 1:NP_649019.2 Gene:CG5535 / 39990 FlyBaseID:FBgn0036764 Length:630 Species:Drosophila melanogaster
Sequence 2:XP_001066729.3 Gene:LOC688389 / 688389 RGDID:1589989 Length:469 Species:Rattus norvegicus


Alignment Length:414 Identity:90/414 - (21%)
Similarity:173/414 - (41%) Gaps:59/414 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 KLAKVLSAFDLTALGIGSTLGVGVYVLAGEVSKQYAGPAVVVSFLIAAIASIFAG---------L 90
            :|::.:..|.:|.:.:|:.:|.|::|....|.| |:...:.||.      .|:||         |
  Rat     2 RLSRTVGFFHVTMVLLGTIIGTGIFVSPKGVLK-YSSLNIPVSL------GIWAGCGLLVMLNAL 59

  Fly    91 CYAEFGARVPKAGSAYIYSYVTIGEFIAFLIGWNLILEYAIGSASVVKGLSTYLDQ--LCGNPMS 153
            ...|.....|.:|::|.:...::|...|||..|..:..|.:|..:....::|||.|  ..|.|  
  Rat    60 SLVELATTFPVSGASYYFLKRSLGSLAAFLSLWIQLFSYCLGLGAHTLLIATYLIQPFYTGCP-- 122

  Fly   154 SFLGTHMPLNIEGMGAYPDLFAFVVTILFSLAI--AVGAKESTRVNNVFTMLNLGVVLFVIIAGL 216
               ...:|:.           ...|.||:|..|  |.|.|....:..:.:|:.:.::.|:.:.||
  Rat   123 ---APELPIK-----------CLSVAILWSFGILNAGGVKTVAWLQTISSMIKMSILCFISLTGL 173

  Fly   217 -FKVSSSNWSIPK------SQVPEGYGDGGFMPYGVSGIIKGAAVCFYGFIGFDCIATAGEEAKN 274
             ..|.....::.|      :::|..       ...|..|::|   || .:.|...:.....|.||
  Rat   174 VLLVIGKKENVSKFENALDAELPNA-------SQTVEAILQG---CF-AYRGIFIVINIAGEIKN 227

  Fly   275 PKKSIPFAVIVSLAMIFLAYFGVSTV-LTMMLP-YFEQDEKAPLPHVFRINGWHVAEYVVSIGAM 337
            |.|.||.|||..|::..::|...:.. ||::.| .....:...:..|.|  .:...::|:|:|..
  Rat   228 PSKIIPKAVISCLSITIMSYLLANVAYLTVLTPKEITTSDSVVITWVNR--AYPSMQWVMSLGIS 290

  Fly   338 FGLCSSMMGAMFPLPRIVFAMSNDGLLFKFLGDISEKYKTPFKGTMITGMLTGILAAVFNLSQLV 402
            ....::....:....||.::.|.:|.: .|:..:...:::|........:|:.:.....||:.|:
  Rat   291 LSSLTTTACGILSAARICYSASLEGQM-PFIFSMLNNHQSPVVAVTQVVILSTVSIICSNLTYLI 354

  Fly   403 NMMSIGTLLAYSMVASCVLMLRYE 426
            ..:.|.::....:....:|.|||:
  Rat   355 KYLGIMSIFNDVLYMIAILKLRYQ 378

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5535NP_649019.2 2A0303 20..585 CDD:273330 90/414 (22%)
AA_permease_C 535..585 CDD:290617
LOC688389XP_001066729.3 PotE 1..437 CDD:223605 90/414 (22%)
SLC5-6-like_sbd 5..>266 CDD:294310 69/294 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166351241
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.930

Return to query results.
Submit another query.