DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5535 and Slc7a15

DIOPT Version :9

Sequence 1:NP_649019.2 Gene:CG5535 / 39990 FlyBaseID:FBgn0036764 Length:630 Species:Drosophila melanogaster
Sequence 2:NP_001100184.1 Gene:Slc7a15 / 298873 RGDID:1560726 Length:488 Species:Rattus norvegicus


Alignment Length:396 Identity:93/396 - (23%)
Similarity:167/396 - (42%) Gaps:41/396 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 SAFDLTALGIGSTLGVGVYVLAGEVSKQYAGP-AVVVSFLIAAIASIFAGLCYAEFGARVPKAGS 104
            ||..:||   |..:|.|:::....|......| |.::.:....:.::...|||||.|:.||::|.
  Rat    35 SAVSMTA---GCMIGSGIFMSPQGVLVYIGSPGASLIIWATCGLLALLGALCYAELGSLVPESGG 96

  Fly   105 AYIYSYVTIGEFIAFLIGWNLILEYAIGSASVVKGLSTYLDQLCGNPMSSFLGTHMPLNIEGMGA 169
            .|.|.....|...|||:.:.::|   :|..:.:..:|.           ||....:.....|..:
  Rat    97 EYAYILRAFGSLPAFLVIYIIVL---VGRPAAITAVSL-----------SFAEYALAPFYPGCSS 147

  Fly   170 YPDLFAFVVT---ILFSLAIAV-GAKESTRVNNVFTMLNLGVVLFVIIAGLFKVSSSNWSIPKSQ 230
            .|.:...:|.   ||..|.|.. .::.||.:.||.|...|..:|.:::.|  .|..:...||...
  Rat   148 VPQVIVKIVACSCILVLLLINFWSSRMSTVLMNVCTAAKLFSLLVIVVGG--AVGLAQGRIPTES 210

  Fly   231 VPEGYGDGGFMPYGVSGIIKGAAVCFY----GFIGFDCIATAGEEAKNPKKSIPFAVIVSLAMIF 291
            :.       |..:..:.......:.||    .|.|:..|.|..||.||||:::.:||::::.::.
  Rat   211 LL-------FAFHNTTQQAGRIGMAFYQGLWSFDGWSNINTVIEEIKNPKQNLVWAVVIAIPLVT 268

  Fly   292 LAYFGVS-TVLTMMLP--YFEQDEKAPLPHVFRINGWHVAEYVVSIGAMFGLCSSMMGAMFPLPR 353
            :.|..|: :.|.:|.|  ....|..|.......:..|   .::|.:........::.|..|...|
  Rat   269 ILYVLVNISYLLVMSPSEILTSDAIAVTWGNQVLGSW---AWLVPLAVALSTFGAVNGGFFSGSR 330

  Fly   354 IVFAMSNDGLLFKFLGDISEKYKTPFKGTMITGMLTGILAAVFNLSQLVNMMSIGTLLAYSMVAS 418
            :.:|.:.:|.:.:.:..|.....||....:.|..:..:|....|.|..||::|..:.|.|....:
  Rat   331 VCYAAAREGHMPQLMSMIHVHRLTPAPALIFTTAVALLLVIPGNFSTFVNLLSFLSWLTYGTTFA 395

  Fly   419 CVLMLR 424
            |:|.||
  Rat   396 CLLYLR 401

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5535NP_649019.2 2A0303 20..585 CDD:273330 93/396 (23%)
AA_permease_C 535..585 CDD:290617
Slc7a15NP_001100184.1 2A0308 4..481 CDD:273332 93/396 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166351220
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53617
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.850

Return to query results.
Submit another query.