DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5535 and Slc7a12

DIOPT Version :9

Sequence 1:NP_649019.2 Gene:CG5535 / 39990 FlyBaseID:FBgn0036764 Length:630 Species:Drosophila melanogaster
Sequence 2:NP_001011948.1 Gene:Slc7a12 / 294881 RGDID:1309208 Length:472 Species:Rattus norvegicus


Alignment Length:425 Identity:87/425 - (20%)
Similarity:173/425 - (40%) Gaps:75/425 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 KLAKVLSAFDLTALGIGSTLGVGVYVLAGEVSKQYAGPAVVVSFLIAAIASIFAG---------L 90
            :|.:.|..|.:......:|:|.|::|....|.|       ..|..|....||:||         :
  Rat     2 QLLRGLGFFHVNMFLFSATIGTGIFVSPKGVLK-------YCSLNIPIFLSIWAGCGLLSMMNAV 59

  Fly    91 CYAEFGARVPKAGSAYIYSYVTIGEFIAFLIGWNLILEYAIGSASVVKGLSTYLDQL----CGNP 151
            |.||..|..|.:|::|.:....:|..:|||..|..|....:|.::....:::.|.|.    |..|
  Rat    60 CLAEIAATYPVSGASYYFLKRALGSSVAFLSIWIKIFACTLGISAQCLLIASSLIQCFYSECQAP 124

  Fly   152 MSSFLGTHMPLNIEGMGAYPDLFAFVVTILFSLAI--AVGAKESTRVNNVFTMLNLGVVLFVIIA 214
                   .:|..           ...:.||:|..|  |.|.|.....|.:.:::.|.|:..:.:.
  Rat   125 -------ELPKK-----------CLALAILWSFGILSARGIKPVAWFNTISSLMKLSVLCLISLT 171

  Fly   215 GLF--------KVSSSNWSIPKSQVPEGYGDGGFMPYGVSGIIKGAAVCFYGFIGFDCIATAGEE 271
            |:.        .||....:: ::::|           .||.|.:.....:|.::|...:.....|
  Rat   172 GIVLLVIGKKENVSRFEKAL-EAELP-----------NVSQIAEAILQVYYAYLGSSFLIVIAGE 224

  Fly   272 AKNPKKSIPFAVIVSLAMIFLAYF--GVSTVLTMMLPYFEQDEKAPLPHVFRINGWHVAEYVVSI 334
            .|.|.::||.::|..|:::.:.|.  .||.:..:........:...:..:.|:  :...::::|:
  Rat   225 IKRPAETIPKSIIYGLSVVTVLYLLTNVSFLAVLTSEEIISSDSVAVTWMNRV--FPSMQWIISL 287

  Fly   335 GAMFGLCSSMMGAMFPLPRIVFAMSNDG---LLFKFLGDISEKYKTPFKGTMITGMLTGILAAVF 396
            .....|..|:...:....||.:|.|.:|   .::..|.|:........:..:::.:  ||:::  
  Rat   288 LISAFLFGSVSCGIVSASRIFYATSQEGQFPFIYSMLNDLHSPVVADLQAVILSSV--GIISS-- 348

  Fly   397 NLSQLVNMMSIGT--LLAYSMVASCVLMLRYEVDD 429
            |:..|:..:.:||  |...:|:.  :|.|||:..|
  Rat   349 NMIYLIKYVGLGTWCLNLLNMIG--LLKLRYQNPD 381

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5535NP_649019.2 2A0303 20..585 CDD:273330 87/425 (20%)
AA_permease_C 535..585 CDD:290617
Slc7a12NP_001011948.1 2A0308 21..423 CDD:273332 83/406 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166351238
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.930

Return to query results.
Submit another query.