DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5535 and isp5

DIOPT Version :9

Sequence 1:NP_649019.2 Gene:CG5535 / 39990 FlyBaseID:FBgn0036764 Length:630 Species:Drosophila melanogaster
Sequence 2:NP_595000.1 Gene:isp5 / 2543028 PomBaseID:SPAC1039.09 Length:580 Species:Schizosaccharomyces pombe


Alignment Length:431 Identity:92/431 - (21%)
Similarity:162/431 - (37%) Gaps:98/431 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 PLEDSNESKLAKVLSAFDLTALGIGSTLGVGVYVLAGEVSKQYAGPAVVVSFLIAAIASIFAGLC 91
            |.||....||.:.|:|..:..:|||..:|.||:|.:....::....:|::.:.:.....:.....
pombe    70 PPEDGKPQKLKRTLTARHIQMIGIGGAIGTGVWVGSKNTLREGGAASVLICYSLVGSMVLMTVYS 134

  Fly    92 YAEFGARVPKAGSAYIYSYVTIGEFIAFLIGWNLILEY------AIGSASVVKGLSTYLDQLCGN 150
            ..|.....|..||.:.|....|.....|.:|||.:..:      .:.:||:.  |..:::...|.
pombe   135 LGELAVAFPINGSFHTYGTRFIHPSWGFTLGWNYLASFLATYPLELITASIC--LQFWININSGI 197

  Fly   151 PMSSFLGTHMPLNIEGMGAYPDLFAFVVTILFSLAIAVGAKESTRVNNVFTMLNLGVVLFVIIAG 215
            .::.|:.....:|:.|:..|.::..||.::                 .|..|:...:...||..|
pombe   198 WITVFIALLCFVNMFGVRGYGEVEFFVSSL-----------------KVMAMVGFIICGIVIDCG 245

  Fly   216 LFKVSSSNW----SIPKSQVPEGYGDGGFMPYGVSGIIKGAAVCFYGFIGFDCIATAGEEAKNPK 276
            ..:.....:    ...|:....|:       :|...:...||   :.:.|.:.|..|..|.|||.
pombe   246 GVRTDHRGYIGATIFRKNAFIHGF-------HGFCSVFSTAA---FSYAGTEYIGIAASETKNPA 300

  Fly   277 KSIPFAV-----IVSLAMIFLAYFGVSTVLTMMLPYFEQDEK-------APLPHVF-----RING 324
            |:.|.||     .|||..| ||.|.||.:::      .:||:       |..|.:.     :|.|
pombe   301 KAFPKAVKQVFIRVSLFYI-LALFVVSLLIS------GRDERLTTLSATAASPFILALMDAKIRG 358

  Fly   325 W-HVAEYVVSIGAMFGLCSSMMGAMFPLPRIVFAMSNDG----------------------LLFK 366
            . ||...|:.|..:    ::..|..:...|.:.:|:..|                      |.|.
pombe   359 LPHVLNAVILISVL----TAANGITYTGSRTLHSMAEQGHAPKWFKYVDREGRPLLAMAFVLCFG 419

  Fly   367 FLGDISEKYKTPFKGTMITGMLTGILAAVFNLSQLVNMMSI 407
            .||.|.|..::   .|:...:|     ::.||:.|...:||
pombe   420 ALGYICESAQS---DTVFDWLL-----SISNLATLFVWLSI 452

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5535NP_649019.2 2A0303 20..585 CDD:273330 92/431 (21%)
AA_permease_C 535..585 CDD:290617
isp5NP_595000.1 LysP 37..579 CDD:223903 92/431 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1286
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 75 1.000 Inparanoid score I1891
OMA 1 1.010 - - QHG53617
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X81
TreeFam 00.000 Not matched by this tool.
43.960

Return to query results.
Submit another query.