DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5535 and SPBC1652.02

DIOPT Version :9

Sequence 1:NP_649019.2 Gene:CG5535 / 39990 FlyBaseID:FBgn0036764 Length:630 Species:Drosophila melanogaster
Sequence 2:NP_596769.2 Gene:SPBC1652.02 / 2540163 PomBaseID:SPBC1652.02 Length:594 Species:Schizosaccharomyces pombe


Alignment Length:386 Identity:88/386 - (22%)
Similarity:151/386 - (39%) Gaps:62/386 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 SVTNAFRVLTRKKPLEDSNESKLAKVLSAFD------LTALGIGSTLGVGVYVLAGEVSKQYAGP 72
            ||..:|....|...|...||  .|:|.::.|      |..:.|||.:|.|::|..|: |.:.|||
pombe    39 SVGTSFLDFFRSYKLRPDNE--FAEVHNSEDFLKPRHLQMIAIGSCIGTGLFVSTGK-SLKNAGP 100

  Fly    73 -AVVVSFLIAAIASIFAGLCYAEFGARVPKAGSAYIYSYVTIGEFIAFLIGWNLILEYAIGSASV 136
             :::::|:|.:...:...|...|....:|...|..:|:...:...|.|...|.....:.....|.
pombe   101 GSLMINFIILSAMILALILSLGEMCCFLPNQSSITMYTGRLLNNNIGFAQSWLYFWIWLTVLPSE 165

  Fly   137 VKGLSTYLDQLCGNPMSSFLGTHMPLNIEGMGAYPDLFAFVVTILFSLAIAVGAKESTRVNNVFT 201
            :......:|          ..|...||       |.::..:......|..|.||:.......|.:
pombe   166 ISAACEVVD----------FWTTQHLN-------PAIWVTIFLAYVVLVNAFGARSYGECEFVSS 213

  Fly   202 MLNLG-VVLFVIIAGLFKVSSSNWSIPKSQVPEGYGDGGFM-------PYGVSGIIKGAAVCF-- 256
            .|.:. |::|..:|.:....::    ||         ||::       |.......||....|  
pombe   214 FLKVVIVIIFFFVAIIINCGAA----PK---------GGYIGAHYWHHPGSFRNGFKGFCSVFIS 265

  Fly   257 --YGFIGFDCIATAGEEAKNPKKSIPFAVIVSLAMIF--LAYFGVSTV--LTMMLPYFEQDEKAP 315
              |...|.:.|.||.....||:::||.||    ..:|  :.:|.:.|:  :|:::||...|....
pombe   266 SAYSLSGTENIGTAAGNTSNPQRAIPSAV----KKVFYRMGFFYIITIFLITLVVPYDNPDLGNV 326

  Fly   316 LPHVFRI--NGWHVAEYVVSIGAMFGLCSSMMGAMFPLPRIVFAMSNDGLLFKFLGDISEK 374
            .|.:..|  .|.||..::.:...:..:.|....|:|...|...|:...|...:|||.:.:|
pombe   327 SPFIIAIKNGGIHVLPHITNAVILVSVLSVGNAAVFAASRNAMALVKQGWAPRFLGRVDQK 387

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5535NP_649019.2 2A0303 20..585 CDD:273330 85/380 (22%)
AA_permease_C 535..585 CDD:290617
SPBC1652.02NP_596769.2 LysP 31..542 CDD:223903 88/386 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1286
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53617
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X81
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.