DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5535 and SPCC584.13

DIOPT Version :9

Sequence 1:NP_649019.2 Gene:CG5535 / 39990 FlyBaseID:FBgn0036764 Length:630 Species:Drosophila melanogaster
Sequence 2:NP_588218.1 Gene:SPCC584.13 / 2539095 PomBaseID:SPCC584.13 Length:544 Species:Schizosaccharomyces pombe


Alignment Length:458 Identity:110/458 - (24%)
Similarity:178/458 - (38%) Gaps:136/458 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 SNESKLA---------KVLSAF-----DLTALGIGSTLGVGVYVLAGEVSKQYAG-PAVVVSFLI 80
            |:|:.||         :..||:     ..:.||:..:....:|...|     ||| ||:|..:||
pombe    23 SDEADLAALGYKQEFKREFSAWTSFCVSFSVLGLLPSFASTMYYTTG-----YAGTPAMVWGWLI 82

  Fly    81 A-----AIASIFAGLCYAEFGARVPKAGSAYIYSYVTI----GEFIAFLIGWNLILEYAIGSASV 136
            |     .:|:..|.||     :.:|.:|..|..:.|..    |.|.|:|.||             
pombe    83 AMVFVQCVANGMAELC-----SSMPTSGGLYYAAAVLAPKGWGPFAAWLTGW------------- 129

  Fly   137 VKGLSTYLDQLCGNP--MSSFLG-------THMPLNIEGMGAYPDLFAFVVTILFSLAIAVGAKE 192
                |.||.|:.|.|  ..||.|       .|.| |.|....  .:|...|..:    ||.|...
pombe   130 ----SNYLVQVTGPPSVAYSFAGMILTLVQLHNP-NFETQNY--QIFLLAVAAM----IAQGFIS 183

  Fly   193 S--TRVNNVF----TMLN---LGVVLFVIIAGLFKVSSSNWSIPKSQVPEGY------------- 235
            |  |:|..||    |:||   |.:|:..::|           :..::.|.|:             
pombe   184 SMPTKVLAVFNTWGTVLNMLFLAIVMITVLA-----------VAGTKTPRGFNSNHKVWNEFDNQ 237

  Fly   236 ---GDGGFMPYGVSGIIKGAAVCFYGFIGFDCIATAGEEAKNPKKSIPFAVIVSLAMIFLAYFG- 296
               .:|..|....:|:|       :...|:|......||..|...:.|.|::::.|      || 
pombe   238 TDWSNGMAMLMSFAGVI-------WTMSGYDSPFHLSEECSNASVAAPRAIVMTSA------FGG 289

  Fly   297 -VSTVLTMMLPYFEQDEKAPL------PHVFRINGWHVAEY--VVSIGAMFGLCSSMM--GAMFP 350
             |..:|.:.:.|...|..|.:      |.|..:.  .|..|  .|::.::..:||.||  |.|..
pombe   290 IVGWLLNLCIAYTIVDVNAAMNDDLGQPFVVYLR--QVCNYKTTVALTSLTVICSFMMGQGCMVA 352

  Fly   351 LPRIVFAMSNDGL--LFKFLGDISEKYKTPFKGTMITGMLTGILAA--VFNLSQLVN-MMSIGTL 410
            ..|:.::.:.||:  ..|:|..:.::.||| ...:...::.|||..  :|.....:| :.|:|.:
pombe   353 ASRVTYSYARDGVFPFSKYLAIVDKRTKTP-NVCVWMNVVVGILCCLLIFAGEAAINAIFSVGAI 416

  Fly   411 LAY 413
            .|:
pombe   417 AAF 419

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5535NP_649019.2 2A0303 20..585 CDD:273330 110/458 (24%)
AA_permease_C 535..585 CDD:290617
SPCC584.13NP_588218.1 2A0304 28..511 CDD:273331 108/453 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2006
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.