DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5535 and SLC7A8

DIOPT Version :9

Sequence 1:NP_649019.2 Gene:CG5535 / 39990 FlyBaseID:FBgn0036764 Length:630 Species:Drosophila melanogaster
Sequence 2:NP_036376.2 Gene:SLC7A8 / 23428 HGNCID:11066 Length:535 Species:Homo sapiens


Alignment Length:418 Identity:94/418 - (22%)
Similarity:168/418 - (40%) Gaps:62/418 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 LAKVLSAFDLTALGIGSTLGVGVYVL-------AGEVSKQYAGPAVVVSFLIAAIASIFAGLCYA 93
            |.|.:.......:.:|:.:|.|::|.       ||.|     |.|::| :::....::...||||
Human    36 LKKEIGLVSACGIIVGNIIGSGIFVSPKGVLENAGSV-----GLALIV-WIVTGFITVVGALCYA 94

  Fly    94 EFGARVPKAGSAYIYSYVTIGEFIAFLIGWNLILE-YAIGSASVVKGLSTYLDQ----LCGNPMS 153
            |.|..:||:|..|.|.....|....||..|..:|. |....|.:....|.|:.|    .|..|.|
Human    95 ELGVTIPKSGGDYSYVKDIFGGLAGFLRLWIAVLVIYPTNQAVIALTFSNYVLQPLFPTCFPPES 159

  Fly   154 SFLGTHMPLNIEGMGAYPDLFAFVVTILFSLAIAVGAKESTRVNNVFTMLNLGVVLFVIIAGLFK 218
            ..                .|.|.:..:|.:.......:.:|||.::||...|..:..:||.|:.:
Human   160 GL----------------RLLAAICLLLLTWVNCSSVRWATRVQDIFTAGKLLALALIIIMGIVQ 208

  Fly   219 VSSSN--WSIPKS-----QVPEGYGDGGFMPYGVSGIIKGAAVCF----YGFIGFDCIATAGEEA 272
            :....  |..||:     |.|:            .|::   |:.|    :.:.|::.:....||.
Human   209 ICKGEYFWLEPKNAFENFQEPD------------IGLV---ALAFLQGSFAYGGWNFLNYVTEEL 258

  Fly   273 KNPKKSIPFAVIVSLAMIFLAY-FGVSTVLTMMLPYFEQDEKAPLPHVFRINGWHVAEYVVSIGA 336
            .:|.|::|.|:.:|:.::...| |.....:|.|.|. |......:...|......|..:::.|..
Human   259 VDPYKNLPRAIFISIPLVTFVYVFANVAYVTAMSPQ-ELLASNAVAVTFGEKLLGVMAWIMPISV 322

  Fly   337 MFGLCSSMMGAMFPLPRIVFAMSNDGLLFKFLGDISEKYKTPFKGTMITGMLTGILAAVFNLSQL 401
            .......:.|::|...|:.||.:.:|.|...|..|..|..||....:.|.:.|.::....::..|
Human   323 ALSTFGGVNGSLFTSSRLFFAGAREGHLPSVLAMIHVKRCTPIPALLFTCISTLLMLVTSDMYTL 387

  Fly   402 VNMMSIGTLLAYSMVASCVLMLRYEVDD 429
            :|.:.....|.|.:..:..::||::..|
Human   388 INYVGFINYLFYGVTVAGQIVLRWKKPD 415

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5535NP_649019.2 2A0303 20..585 CDD:273330 94/418 (22%)
AA_permease_C 535..585 CDD:290617
SLC7A8NP_036376.2 2A0308 1..497 CDD:273332 94/418 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..30
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 502..535
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165157277
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53617
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.850

Return to query results.
Submit another query.