DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5535 and Slc7a12

DIOPT Version :9

Sequence 1:NP_649019.2 Gene:CG5535 / 39990 FlyBaseID:FBgn0036764 Length:630 Species:Drosophila melanogaster
Sequence 2:NP_543128.1 Gene:Slc7a12 / 140918 MGIID:2156159 Length:465 Species:Mus musculus


Alignment Length:419 Identity:86/419 - (20%)
Similarity:169/419 - (40%) Gaps:65/419 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 KLAKVLSAFDLTALGIGSTLGVGVYVLAGEVSKQYAGPAVVVSFLIAA---IASIFAGLCYAEFG 96
            :|.:.|..|.::.:...:|||.|::|....|.| |:...:.||..|.|   :.||.:.||.||..
Mouse     2 QLLRALGVFHVSMILFSATLGTGIFVTPKAVLK-YSSLNIPVSLSIWAGCGLLSIMSALCNAEIA 65

  Fly    97 ARVPKAGSAYIYSYVTIGEFIAFLIGWNLILEYAIGSASVVKGLSTYLDQLC---GNPMSSFLGT 158
            ...|.:|::|.:...|:|..:|||..|..:..:.:|..:....::|.:.| |   |.|.      
Mouse    66 TTYPLSGASYYFLKRTLGSSVAFLSLWIKLFAHFLGIGAQCLLIATSVIQ-CFYSGCPA------ 123

  Fly   159 HMPLNIEGMGAYPDL----FAFVVTILFSLAIAVGAKESTRVNNVFTMLNLGVVLFVIIAGLFKV 219
                        |:|    .|..:...|.:..|.|.|.....|.|.:.:.|.|:..:.:..|. |
Mouse   124 ------------PELPTKCLALAILWSFGIVSARGIKTVAWFNTVSSFIKLSVLCLISLTVLL-V 175

  Fly   220 SSSNWSIPK------SQVPEGYGDGGFMPYGVSGIIKGAAVCFYGFIGFDCIATAGEEAKNPKKS 278
            :....::.:      :::|           ..|.|........|.::|...:.....|.|.|.::
Mouse   176 NGKKENVSRFENALDAELP-----------NASQIADAILQVSYSYLGSSVLIVIAGEIKRPTET 229

  Fly   279 IPFAVIVSLAMIFLAYF--GVS--TVLTMMLPYFEQDEKAP-LPHVFRINGWHVAEYVVSIGAMF 338
            ||..:|..::::.:.|.  .:|  .|||.....|....... :..||....| ::.:::|...:.
Mouse   230 IPKTLIYGISIVTVLYLLTNISYLAVLTSQEIIFSDSVGVTWMNRVFPSIQW-ISSFLISAFLLG 293

  Fly   339 GLCSSMMGAMFPLPRIVFAMSNDG---LLFKFLGDISEKYKTPFKGTMITGMLTGILAAVFNLSQ 400
            .:...::.|    .|:.::.|.:|   .::..|.|    :.:|....:...:|:.:.....::..
Mouse   294 SVSCGIVSA----SRVFYSASQEGEFPSIYSMLND----HHSPAVADIQIVILSSVAIISSSIIY 350

  Fly   401 LVNMMSIGTLLAYSMVASCVLMLRYEVDD 429
            ||..:|:|:.....:....:|.:||:..|
Mouse   351 LVKYVSLGSFCINLLQMIGLLKIRYQNPD 379

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5535NP_649019.2 2A0303 20..585 CDD:273330 86/419 (21%)
AA_permease_C 535..585 CDD:290617
Slc7a12NP_543128.1 AA_permease_2 7..412 CDD:290254 85/414 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167847672
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.