DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5535 and Slc7a9

DIOPT Version :9

Sequence 1:NP_649019.2 Gene:CG5535 / 39990 FlyBaseID:FBgn0036764 Length:630 Species:Drosophila melanogaster
Sequence 2:NP_446381.1 Gene:Slc7a9 / 116726 RGDID:619905 Length:487 Species:Rattus norvegicus


Alignment Length:427 Identity:96/427 - (22%)
Similarity:179/427 - (41%) Gaps:70/427 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 SNESK---LAKVLSAFDLTALGIGSTLGVGVYVLAGEV--SKQYAGPAVVVSFLIAAIASIFAGL 90
            |.|.|   |.|.:.......:.:|:.:|.|:::....|  :.:..||.:::......:|::.| |
  Rat    18 STEPKTTSLQKEVGLLSGICIIVGTIIGSGIFISPKSVLANTESVGPCLIIWAACGVLATLGA-L 81

  Fly    91 CYAEFGARVPKAGSAYIYSYVTIGEFIAFLIGWNLILEYAIGSASVVKGLSTYLDQLCGNPMSSF 155
            |:||.|..:.|:|..|.|.....|...|:|..|..::.....|.:::  ..::.:.:|.   :.:
  Rat    82 CFAELGTMITKSGGEYPYLMEAFGPIPAYLFSWTSLIVMKPSSFAII--CLSFSEYVCA---AFY 141

  Fly   156 LGTHMPLNIEGMGAYPDLFAFVVTILFSLAI-------AVGAKESTRVNNVFTMLNLGVVLFVII 213
            ||...|             |.||.:|.:.||       |:..:..:.|.||||...|.:|..:||
  Rat   142 LGCRPP-------------AVVVKLLAAAAILLITTVNALSVRLGSYVQNVFTAAKLVIVAIIII 193

  Fly   214 AGLFKVSSSNW-----SIPKSQVPEGYGDGGFMPYGVSGIIKGAAVCFY----GFIGFDCIATAG 269
            :||..::..|.     |...||...|                ..::.||    .:.|::.:....
  Rat   194 SGLVLLAQGNVKNFQNSFEGSQTSVG----------------SISLAFYNGLWAYDGWNQLNYIT 242

  Fly   270 EEAKNPKKSIPFAVIVSLAMIF-------LAYFGVSTVLTMMLPYFEQDEKAPLPHVFRINGWHV 327
            ||.:||.:::|.|:::.:.::.       :|||.|.|...::     |.:...:....|:  .:.
  Rat   243 EELRNPYRNLPMAIVIGIPLVTVCYILMNIAYFTVMTPTELL-----QSQAVAVTFGDRV--LYP 300

  Fly   328 AEYVVSIGAMFGLCSSMMGAMFPLPRIVFAMSNDGLLFKFLGDISEKYKTPFKGTMITGMLTGIL 392
            |.:||.:...|....:..|..|...|:::....:|.:.|.|..||.|..||....:..|::..|.
  Rat   301 ASWVVPLFVAFSTIGAANGTCFTAGRLIYVAGREGHMLKVLSYISVKRLTPAPALVFYGIIAIIY 365

  Fly   393 AAVFNLSQLVNMMSIGTLLAYSMVASCVLMLRYEVDD 429
            ....:::.|||..|....|.|.|....::::|:...|
  Rat   366 IIPGDINSLVNYFSFAAWLFYGMTILGLVVMRFTRKD 402

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5535NP_649019.2 2A0303 20..585 CDD:273330 96/427 (22%)
AA_permease_C 535..585 CDD:290617
Slc7a9NP_446381.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..23 2/4 (50%)
2A0308 13..484 CDD:273332 96/427 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166351263
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53617
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.