DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5535 and SLC7A9

DIOPT Version :9

Sequence 1:NP_649019.2 Gene:CG5535 / 39990 FlyBaseID:FBgn0036764 Length:630 Species:Drosophila melanogaster
Sequence 2:NP_001119807.1 Gene:SLC7A9 / 11136 HGNCID:11067 Length:487 Species:Homo sapiens


Alignment Length:492 Identity:110/492 - (22%)
Similarity:211/492 - (42%) Gaps:89/492 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 KKPLED-----SNESK---LAKVLSAFDLTALGIGSTLGVGVYVLAGEV--SKQYAGPAVVVSFL 79
            :|..||     |.|.|   |.|.|......::.:|:.:|.|::|....|  :.:..||.:::...
Human     7 RKRREDEKSIQSQEPKTTSLQKELGLISGISIIVGTIIGSGIFVSPKSVLSNTEAVGPCLIIWAA 71

  Fly    80 IAAIASIFAGLCYAEFGARVPKAGSAYIYSYVTIGEFIAFLIGW-NLILEYAIGSASVVKGLSTY 143
            ...:|::.| ||:||.|..:.|:|..|.|.....|...|:|..| :||:......|.:....|.|
Human    72 CGVLATLGA-LCFAELGTMITKSGGEYPYLMEAYGPIPAYLFSWASLIVIKPTSFAIICLSFSEY 135

  Fly   144 LDQLCGNPMSSFLGTHMP-LNIEGMGAYPDLFAFVVTILFSLAIAVGAKESTRVNNVFTMLNLGV 207
               :|. |.  ::|...| :.::.:.|...||   ::.:.||::.:|    :.|.|:||...|.:
Human   136 ---VCA-PF--YVGCKPPQIVVKCLAAAAILF---ISTVNSLSVRLG----SYVQNIFTAAKLVI 187

  Fly   208 VLFVIIAGLFKVSSSNWSIPKSQVPEGYGDGGFMPYGVSGIIKGAAVCFY----GFIGFDCIATA 268
            |..:||:||..::..|        .:.: |..|  .|....:...::.||    .:.|::.:...
Human   188 VAIIIISGLVLLAQGN--------TKNF-DNSF--EGAQLSVGAISLAFYNGLWAYDGWNQLNYI 241

  Fly   269 GEEAKNPKKSIPFAVIVSLAMIF-------LAYFGVSTVLTMMLPYFEQDEKAPLPHVFRINGWH 326
            .||.:||.:::|.|:|:.:.::.       ::||.|.|...::     |.:...:....|:  .:
Human   242 TEELRNPYRNLPLAIIIGIPLVTACYILMNVSYFTVMTATELL-----QSQAVAVTFGDRV--LY 299

  Fly   327 VAEYVVSIGAMFGLCSSMMGAMFPLPRIVFAMSNDGLLFKFLGDISEKYKTPFKGTMITGMLTGI 391
            .|.::|.:...|....:..|..|...|:::....:|.:.|.|..||.:..||....:..|::..|
Human   300 PASWIVPLFVAFSTIGAANGTCFTAGRLIYVAGREGHMLKVLSYISVRRLTPAPAIIFYGIIATI 364

  Fly   392 LAAVFNLSQLVNMMSIGTLLAYSMVASCVLMLRYEVDDRRESRIVANGRATGLEQDRPCALWRRI 456
            .....:::.|||..|....|.|.:....::::|:                |..|.:||.      
Human   365 YIIPGDINSLVNYFSFAAWLFYGLTILGLIVMRF----------------TRKELERPI------ 407

  Fly   457 FNLNGQTVPTKQTSRIVTYSVTLFSLWCMVFSQILTK 493
                  .||.     ::...:||.|:: :|.:.|::|
Human   408 ------KVPV-----VIPVLMTLISVF-LVLAPIISK 432

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5535NP_649019.2 2A0303 20..585 CDD:273330 110/492 (22%)
AA_permease_C 535..585 CDD:290617
SLC7A9NP_001119807.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..22 5/14 (36%)
2A0308 26..484 CDD:273332 104/473 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165157295
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53617
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.850

Return to query results.
Submit another query.