DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TrpRS-m and Wars

DIOPT Version :9

Sequence 1:NP_001262001.1 Gene:TrpRS-m / 39989 FlyBaseID:FBgn0036763 Length:665 Species:Drosophila melanogaster
Sequence 2:NP_035840.3 Gene:Wars / 22375 MGIID:104630 Length:481 Species:Mus musculus


Alignment Length:382 Identity:77/382 - (20%)
Similarity:138/382 - (36%) Gaps:126/382 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 HPHGNSVNSGHEEHNTRWPRKVFSGIQPTG-SLHLGNYLGAV-RKWVQ--------LQNARD--- 112
            |...|.:...:|   .:.|..:::|..|:. ::|||:.:..: .||:|        :|.:.|   
Mouse   144 HRDMNQILDAYE---NKKPFYLYTGRGPSSEAMHLGHLVPFIFTKWLQDVFNVPLVIQMSDDEKY 205

  Fly   113 ---DVTVCIVDLHSITMPHNPPLLRENIFTMAATLLACGIDPTKSTLFVQSAVAEHAEFNWILSS 174
               |:|  :...:|.|:        ||    |..::|||.|..|:.:|                 
Mouse   206 LWKDLT--LEQAYSYTV--------EN----AKDIIACGFDINKTFIF----------------- 239

  Fly   175 LTTMPRLAQLPQF-REKSRLLKDVP---------------LGLYVYPVLQAA------------- 210
             :.:..:.|.|.| |...::.|.|.               :|...:|.:|||             
Mouse   240 -SDLEYMGQSPGFYRNVVKIQKHVTFNQVKGIFGFTDSDCIGKISFPAVQAAPSFSNSFPKIFRD 303

  Fly   211 --DIMLYKSTHVPVGADQIQHIQLAQHLARIYNGRYGETFPVCTAIIEDGDASRVLSLRDPSKKM 273
              ||...    :|...||..:.::.:.:|    .|.|...|   |::.   ::...:|:....||
Mouse   304 RTDIQCL----IPCAIDQDPYFRMTRDVA----PRIGHPKP---ALLH---STFFPALQGAQTKM 354

  Fly   274 SKSEANPKATINLCDSPDLITQKIKKAVTDFTSDITYNPGKRAGVSNLVNIH------------- 325
            |.|:  |.::|.|.|:...|..|:.|.......| |....::.|.:..|::.             
Mouse   355 SASD--PNSSIFLTDTAKQIKSKVNKHAFSGGRD-TVEEHRQFGGNCEVDVSFMYLTFFLEDDDR 416

  Fly   326 -----------AQVTGQSIKTVVNEAATL---DTAKYKDRVAEAVVEHLRPIREQIH 368
                       |.:||:..||:::....|   ..|:.|....|.|.|.:.|.:...|
Mouse   417 LEQIRKDYTSGAMLTGELKKTLIDVLQPLIAEHQARRKAVTEETVKEFMTPRQLSFH 473

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TrpRS-mNP_001262001.1 PRK00927 82..406 CDD:234866 73/361 (20%)
TrpRS_core 82..359 CDD:173903 70/350 (20%)
WarsNP_035840.3 WEPRS_RNA 16..65 CDD:238473
PLN02486 89..470 CDD:178104 76/377 (20%)
'HIGH' region 168..177 3/8 (38%)
'KMSKS' region 353..357 3/3 (100%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0180
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.