DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TrpRS-m and WARS2

DIOPT Version :9

Sequence 1:NP_001262001.1 Gene:TrpRS-m / 39989 FlyBaseID:FBgn0036763 Length:665 Species:Drosophila melanogaster
Sequence 2:NP_056651.1 Gene:WARS2 / 10352 HGNCID:12730 Length:360 Species:Homo sapiens


Alignment Length:385 Identity:179/385 - (46%)
Similarity:253/385 - (65%) Gaps:29/385 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 AVYSQRRCIQARSFLPGLASRTAGTPSATAQVTGGNKQHVHPHGNSVNSGHEEHNTRWPRKVFSG 85
            |::|.|:..:..||:..|...:|..|:.                        :.:::  ::||||
Human     2 ALHSMRKARERWSFIRALHKGSAAAPAL------------------------QKDSK--KRVFSG 40

  Fly    86 IQPTGSLHLGNYLGAVRKWVQLQNARDDVTVCIVDLHSITMPHNPPLLRENIFTMAATLLACGID 150
            |||||.|||||||||:..||:||:..|.|...||||||||:|.:|.:||::|..|.|.||||||:
Human    41 IQPTGILHLGNYLGAIESWVRLQDEYDSVLYSIVDLHSITVPQDPAVLRQSILDMTAVLLACGIN 105

  Fly   151 PTKSTLFVQSAVAEHAEFNWILSSLTTMPRLAQLPQFREKSRLLK-DVPLGLYVYPVLQAADIML 214
            |.||.||.||.|:||.:.:||||.:..:|||..|.|::.|:...| |..:||..|||||||||:|
Human   106 PEKSILFQQSQVSEHTQLSWILSCMVRLPRLQHLHQWKAKTTKQKHDGTVGLLTYPVLQAADILL 170

  Fly   215 YKSTHVPVGADQIQHIQLAQHLARIYNGRYGETFPVCTAIIEDGDASRVLSLRDPSKKMSKSEAN 279
            |||||||||.||:||::|.|.||:.:|.:|||.|||..:|:.  ...:|.||||||.|||||:.:
Human   171 YKSTHVPVGEDQVQHMELVQDLAQGFNKKYGEFFPVPESILT--SMKKVKSLRDPSAKMSKSDPD 233

  Fly   280 PKATINLCDSPDLITQKIKKAVTDFTSDITYNPGKRAGVSNLVNIHAQVTGQSIKTVVNEAATLD 344
            ..||:.:.|||:.|.||.:||||||||::||:|..||||||:|.:||.|||.|::.||..:|.::
Human   234 KLATVRITDSPEEIVQKFRKAVTDFTSEVTYDPAGRAGVSNIVAVHAAVTGLSVEEVVRRSAGMN 298

  Fly   345 TAKYKDRVAEAVVEHLRPIREQIHHHMTKRNEMIYLLEVGAEKARQQARQTLNDVKQRLG 404
            ||:||..||:||:|...||:.:|......::.:..:|::|:.||::.|.....:||:.:|
Human   299 TARYKLAVADAVIEKFAPIKREIEKLKLDKDHLEKVLQIGSAKAKELAYTVCQEVKKLVG 358

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TrpRS-mNP_001262001.1 PRK00927 82..406 CDD:234866 171/324 (53%)
TrpRS_core 82..359 CDD:173903 159/277 (57%)
WARS2NP_056651.1 PRK00927 34..360 CDD:234866 171/329 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165148045
Domainoid 1 1.000 316 1.000 Domainoid score I1276
eggNOG 1 0.900 - - E1_COG0180
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H5673
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S1214
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003309
OrthoInspector 1 1.000 - - oto88295
orthoMCL 1 0.900 - - OOG6_101334
Panther 1 1.100 - - LDO PTHR43766
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1460
SonicParanoid 1 1.000 - - X2207
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1312.680

Return to query results.
Submit another query.