DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7430 and AIF

DIOPT Version :9

Sequence 1:NP_001262000.1 Gene:CG7430 / 39988 FlyBaseID:FBgn0036762 Length:504 Species:Drosophila melanogaster
Sequence 2:NP_722765.2 Gene:AIF / 33390 FlyBaseID:FBgn0031392 Length:739 Species:Drosophila melanogaster


Alignment Length:345 Identity:79/345 - (22%)
Similarity:125/345 - (36%) Gaps:83/345 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   132 GGIAMLFKKNKVTQLTGFGTIVNPNEVEVKKSDGSTETVKTKN--------ILIATGSEVTPFPG 188
            ||||       |.|  ||         .|||.|.....|...:        .|||||......|.
  Fly   348 GGIA-------VAQ--GF---------SVKKVDAQKRIVTLNDGYEISYDECLIATGCAPKNLPM 394

  Fly   189 I-----EIDEEVIVSST-----GALKLAKVPKHLVVIGAGVIGLELG---SVWSR--LGAEVTAI 238
            :     .:.|:|:|..|     ...|||...:.:.::|.|.||.||.   :.:||  .|.:|..:
  Fly   395 LRDAPPSVLEKVMVYRTPDDFDRLRKLAAEKRSITIVGNGFIGSELACSLAHYSRENNGGKVYQV 459

  Fly   239 EFMDTIGGVGIDNEVSKTFQKVLTKQGLKFKLGTKVTAASRSGDNVTVSVENAKSGEKEEIQCDA 303
            ...:......:.|.:|:.....:..||:.......:.:|.|...|:.:.:.|..:     :..|.
  Fly   460 FQENANMSKVLPNYLSRWTTAKMEAQGVCVIPNASIRSAVRDETNLKLELNNGMT-----LMSDV 519

  Fly   304 LLVSVGRRPYTEGLGLEAVGIVKDDR--GRIPVNATFQTVVPNIYAIGD--CIHGPMLAHKAED- 363
            ::|.||..|.|:..|...:.:   ||  |...|||..: ...|:|..||  |...|:|..:..: 
  Fly   520 VVVCVGCTPNTDLAGPSRLEV---DRSLGGFVVNAELE-ARRNLYVAGDASCFFDPLLGRRRVEH 580

  Fly   364 ------EGLITIEGINGGHVHIDYNCVPSVVYTHPEVAWVGKSEEQLKQEGVAY------KVGKF 416
                  .|.:..|.:.|.          ...|.|..:.|.....| :..||:..      .||.|
  Fly   581 HDHSVVSGRLAGENMTGA----------KKPYQHQSMFWSDLGPE-IGYEGIGLVDSSLPTVGVF 634

  Fly   417 PFLANSRAKT-----NNDTD 431
            ...:.|..:.     ::|:|
  Fly   635 ALPSESATRVDQLSESSDSD 654

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7430NP_001262000.1 PRK06327 35..504 CDD:235779 79/345 (23%)
NADB_Rossmann 35..>74 CDD:304358
Pyr_redox 211..290 CDD:278498 17/83 (20%)
Pyr_redox_dim 385..491 CDD:280934 12/58 (21%)
AIFNP_722765.2 Pyr_redox_2 257..573 CDD:285266 63/251 (25%)
Pyr_redox 427..512 CDD:278498 17/84 (20%)
AIF_C 591..720 CDD:291391 14/75 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45464294
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.