DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7430 and CG4199

DIOPT Version :9

Sequence 1:NP_001262000.1 Gene:CG7430 / 39988 FlyBaseID:FBgn0036762 Length:504 Species:Drosophila melanogaster
Sequence 2:NP_001188537.1 Gene:CG4199 / 31174 FlyBaseID:FBgn0025628 Length:593 Species:Drosophila melanogaster


Alignment Length:392 Identity:87/392 - (22%)
Similarity:144/392 - (36%) Gaps:96/392 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 VVIGSGPGGYVAAIKAAQMGM--KTVSVEKEATLGGTCLNVGCIPSKALLNNSHYYHMAHSGDLE 103
            :|:|.||.|.||.....|.|.  :.:.|.:|..|....:.:    |||:                
  Fly   183 IVVGGGPSGAVAVETIRQEGFTGRLIFVCREDYLPYDRVKI----SKAM---------------- 227

  Fly   104 KRGISCGSVSLDLEKLMGQKSNAVK----ALTGGIAMLFKKNKVTQLTGFGTIVNPNEVEVKKSD 164
                     :|::|:|..:.....|    .|..|:|              ...::..:.|:..|:
  Fly   228 ---------NLEIEQLRFRDEEFYKEYDIELWQGVA--------------AEKLDTAQKELHCSN 269

  Fly   165 GSTETVKTKNILIATGSEV--TPFPGIEIDEEVIV---SSTGALKLAKVPKHLVVIGAGVIGLEL 224
            |  ..||...|.:|||...  .|.||:.::....|   :.|.|:..:..|:..||.        |
  Fly   270 G--YVVKYDKIYLATGCSAFRPPIPGVNLENVRTVRELADTKAILASITPESRVVC--------L 324

  Fly   225 GSVWSRLGAEVTAIEFMDTIGGVGIDN-EVSKTFQKVLTKQGLKFKLGTKVTAASRSGDNVTVSV 288
            ||.:..|.|....:..:.::..||.:| .:...|...:.::.|:.....||.....||....|..
  Fly   325 GSSFIALEAAAGLVSKVQSVTVVGRENVPLKAAFGAEIGQRVLQLFEDNKVVMRMESGIAEIVGN 389

  Fly   289 ENAKSGE-----KEEIQCDALLVSVGRRPYTEGLGLEAVGIVKDDRGRIPVNATFQTVVPNIYAI 348
            |:.|..|     ...:.||.|::..|.:..|:.|....|.:.::  |.:.|....::.||::|..
  Fly   390 EDGKVSEVVLVDDTRLPCDLLILGTGSKLNTQFLAKSGVKVNRN--GSVDVTDFLESNVPDVYVG 452

  Fly   349 GDC----IHGPMLAHKAEDEGLITIEGINGGHVHIDYNCVPSVVYTHPEVAWVGKSEEQLKQEGV 409
            ||.    |||  |||          :.:|.||..:        ...|..||.:.......|.|.|
  Fly   453 GDIANAHIHG--LAH----------DRVNIGHYQL--------AQYHGRVAAINMCGGVKKLEAV 497

  Fly   410 AY 411
            .:
  Fly   498 PF 499

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7430NP_001262000.1 PRK06327 35..504 CDD:235779 87/392 (22%)
NADB_Rossmann 35..>74 CDD:304358 12/34 (35%)
Pyr_redox 211..290 CDD:278498 17/79 (22%)
Pyr_redox_dim 385..491 CDD:280934 6/27 (22%)
CG4199NP_001188537.1 Rieske_AIFL_N 59..154 CDD:239560
Pyr_redox_2 183..465 CDD:285266 76/338 (22%)
Pyr_redox 320..402 CDD:278498 20/89 (22%)
Reductase_C 505..577 CDD:291425
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45464306
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.