DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7430 and GSR

DIOPT Version :9

Sequence 1:NP_001262000.1 Gene:CG7430 / 39988 FlyBaseID:FBgn0036762 Length:504 Species:Drosophila melanogaster
Sequence 2:NP_000628.2 Gene:GSR / 2936 HGNCID:4623 Length:522 Species:Homo sapiens


Alignment Length:480 Identity:139/480 - (28%)
Similarity:221/480 - (46%) Gaps:56/480 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 DIVVIGSGPGGYVAAIKAAQMGMKTVSVEKEATLGGTCLNVGCIPSKALLNNSHYYHMAHSGDLE 103
            |.:|||.|.||..:|.:||::|.:...||.. .|||||:||||:|.|.:.|.:.:....|  |..
Human    66 DYLVIGGGSGGLASARRAAELGARAAVVESH-KLGGTCVNVGCVPKKVMWNTAVHSEFMH--DHA 127

  Fly   104 KRGI-SC-GSVSLDLEKLMGQKSNA-VKALTGGIAMLFKKNKVTQLTGFGTIVNPNEVEVKKSDG 165
            ..|. || |..:.   :::.:|.:| |..|.........|:.:..:.|.....:..:..::.| |
Human   128 DYGFPSCEGKFNW---RVIKEKRDAYVSRLNAIYQNNLTKSHIEIIRGHAAFTSDPKPTIEVS-G 188

  Fly   166 STETVKTKNILIATGS-EVTP----FPGIEIDEEVIVSSTGALKLAKVPKHLVVIGAGVIGLELG 225
            ...|  ..:||||||. ..||    .||..:.    ::|.|..:|.::|...|::|||.|.:|:.
Human   189 KKYT--APHILIATGGMPSTPHESQIPGASLG----ITSDGFFQLEELPGRSVIVGAGYIAVEMA 247

  Fly   226 SVWSRLGAEVTAIEFMDTIGGVGIDNEVSKTFQKVLTKQGLKFKLGTKVTAASRSGDNVTVSVEN 290
            .:.|.||::.:.:...|.:.. ..|:.:|....:.|...|::....::|....::...:.||:..
Human   248 GILSALGSKTSLMIRHDKVLR-SFDSMISTNCTEELENAGVEVLKFSQVKEVKKTLSGLEVSMVT 311

  Fly   291 AKSGEKEEI----QCDALLVSVGRRPYTEGLGLEAVGIVKDDRGRIPVNATFQTVVPNIYAIGD- 350
            |..|....:    ..|.||.::||.|.|:.|.|..:||..||:|.|.|:....|.|..|||:|| 
Human   312 AVPGRLPVMTMIPDVDCLLWAIGRVPNTKDLSLNKLGIQTDDKGHIIVDEFQNTNVKGIYAVGDV 376

  Fly   351 C----------IHGPMLAHK----AEDEGLITIEGINGGHVHIDYNCVPSVVYTHPEVAWVGKSE 401
            |          ..|..|||:    .||..|             |||.:|:||::||.:..||.:|
Human   377 CGKALLTPVAIAAGRKLAHRLFEYKEDSKL-------------DYNNIPTVVFSHPPIGTVGLTE 428

  Fly   402 -EQLKQEGVA-YKVGKFPFLANSRAKTNNDTDGFVKVLADQATDKILGTHIIGPGAGELINEAVL 464
             |.:.:.|:. .|.....|.....|.|...|...:|::.....:|::|.|:.|.|..|::....:
Human   429 DEAIHKYGIENVKTYSTSFTPMYHAVTKRKTKCVMKMVCANKEEKVVGIHMQGLGCDEMLQGFAV 493

  Fly   465 AMEYGAAAEDVARVCHAHPTCSEAL 489
            |::.||...|.......|||.||.|
Human   494 AVKMGATKADFDNTVAIHPTSSEEL 518

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7430NP_001262000.1 PRK06327 35..504 CDD:235779 139/480 (29%)
NADB_Rossmann 35..>74 CDD:304358 14/34 (41%)
Pyr_redox 211..290 CDD:278498 17/78 (22%)
Pyr_redox_dim 385..491 CDD:280934 32/107 (30%)
GSRNP_000628.2 gluta_reduc_1 63..522 CDD:273614 139/480 (29%)
Pyr_redox 233..307 CDD:278498 15/74 (20%)
Pyr_redox_dim 412..520 CDD:280934 32/107 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1249
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D581771at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.