DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7430 and gsr

DIOPT Version :9

Sequence 1:NP_001262000.1 Gene:CG7430 / 39988 FlyBaseID:FBgn0036762 Length:504 Species:Drosophila melanogaster
Sequence 2:NP_001120626.2 Gene:gsr / 100145793 XenbaseID:XB-GENE-997099 Length:590 Species:Xenopus tropicalis


Alignment Length:484 Identity:138/484 - (28%)
Similarity:229/484 - (47%) Gaps:64/484 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 DIVVIGSGPGGYVAAIKAAQMGMKTVSVEKEATLGGTCLNVGCIPSKALLN---NSHYYHMAHSG 100
            |.:|:|.|.||..:|.:||::|.:|..|| .:.|||||:||||:|.|.:.|   :|.|.|     
 Frog   134 DYLVVGGGSGGLASARRAAELGARTAVVE-SSKLGGTCVNVGCVPKKIMWNAAIHSEYIH----- 192

  Fly   101 DLEKRGISCGSVSLDLEKLMGQKSNAVKALTGGIAMLFKKNKVTQLTGFGTIVNPNE--VEVKKS 163
            |.|..|....::....:.:..::...|..|........:|.::..:.|.....:.:|  |||   
 Frog   193 DHEDYGFETSAIKFTWKVIKEKRDAYVSRLNDIYQNNLQKAQIEIIRGQANFTSDSEPTVEV--- 254

  Fly   164 DGSTETVKTKNILIATGSEVTPFPGIEIDEEVI-----VSSTGALKLAKVPKHLVVIGAGVIGLE 223
              :.:.....:||||||.:    |.:..|.||.     ::|.|..:|..:|:..||:|||.|.:|
 Frog   255 --NGQKYIAPHILIATGGK----PSMPSDAEVPGASLGITSDGFFQLTDLPRRSVVVGAGYIAIE 313

  Fly   224 LGSVWSRLGAEVTAIEFMDTIGGVGIDNEVSKTFQKVLTKQGLKFKLGTKVTAASRSGDNVTVSV 288
            :..:.|.||::.:.:...|.:... .|:.:|....:.|...|::.....:|.:..:|...:.::|
 Frog   314 IVGILSALGSKASLLIRQDKVLRT-FDSMISSNCTEELENAGVEVWKYAQVKSVKKSATGLEINV 377

  Fly   289 ENAKSGEKEEIQ----CDALLVSVGRRPYTEGLGLEAVGIVKDDRGRIPVNATFQTVVPNIYAIG 349
            :.:..|.|..::    .|.||.::||.|.||.||||.:|:..|::|.|.|:....|....:||:|
 Frog   378 QCSMPGRKPTVRTIQDVDCLLWAIGRDPNTEDLGLENLGLELDEKGHIVVDEFQNTSRKGVYAVG 442

  Fly   350 D-C----------IHGPMLAHK----AEDEGLITIEGINGGHVHIDYNCVPSVVYTHPEVAWVGK 399
            | |          ..|..|:|:    .||..|             ||:.:|:||::||.:..||.
 Frog   443 DVCGRALLTPVAIAAGRKLSHRLFEGQEDSKL-------------DYDNIPTVVFSHPPIGTVGL 494

  Fly   400 SEEQL----KQEGVAYKVGKFPFLANSRAKTNNDTDGFVKVLADQATDKILGTHIIGPGAGELIN 460
            :||:.    .:|.|  ||....|.....|.|...|...:|::.....:|::|.|:.|.|..|::.
 Frog   495 TEEEAVTAKGRENV--KVYTTSFSPMYHAVTRRKTKCVMKLVCVGKEEKVVGLHMQGLGCDEMLQ 557

  Fly   461 EAVLAMEYGAAAEDVARVCHAHPTCSEAL 489
            ...:|::.||..:|.......|||.||.|
 Frog   558 GFSVAIKMGATKKDFDNTVAIHPTSSEEL 586

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7430NP_001262000.1 PRK06327 35..504 CDD:235779 138/484 (29%)
NADB_Rossmann 35..>74 CDD:304358 14/34 (41%)
Pyr_redox 211..290 CDD:278498 18/78 (23%)
Pyr_redox_dim 385..491 CDD:280934 34/109 (31%)
gsrNP_001120626.2 Pyr_redox_2 131..590 CDD:393463 138/484 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D581771at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.