DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MED19 and AT5G19480

DIOPT Version :9

Sequence 1:NP_001287103.1 Gene:MED19 / 39987 FlyBaseID:FBgn0036761 Length:337 Species:Drosophila melanogaster
Sequence 2:NP_001031907.1 Gene:AT5G19480 / 832068 AraportID:AT5G19480 Length:207 Species:Arabidopsis thaliana


Alignment Length:206 Identity:58/206 - (28%)
Similarity:88/206 - (42%) Gaps:78/206 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 ELTGDKDLMTEYGL--HHTLTKFKEKKFKESL--ASFLQNIPGINDL-------ITHPVENSTLR 116
            ||.|..||:|:|.|  ||..  |.::...|||  |.:|.|:.|..::       :...:.|::|.
plant    13 ELGGALDLITQYKLLPHHEF--FCKRSLPESLSDAHYLHNLVGDTEIRKGEGMQLDQLIPNASLS 75

  Fly   117 S----------VIEKPPIGGKELLPL---TPVQLAGFRLHPGPLPEQYRTTYVTPA--------R 160
            |          |:::.    ||...|   .||:|        |..|:...|.|:.:        |
plant    76 SRDTNARIQPFVLDEL----KEAFELNDTAPVEL--------PPAEKGAPTTVSKSKSESKDKDR 128

  Fly   161 KHKNKHKKQKHKDGVTTGQESTLLDSAGLETYEKKHKKQK-RHED---DKERKK---RKKEKK-- 216
            ||: |||.:|.||                    ::|||.| :|:|   ||::.|   :||||.  
plant   129 KHR-KHKDKKEKD--------------------REHKKHKHKHKDRIKDKDKDKDRDKKKEKSGH 172

  Fly   217 --RKKKNQSPE 225
              :|:||...|
plant   173 HDKKRKNNGTE 183

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MED19NP_001287103.1 Med19 50..202 CDD:287279 45/171 (26%)
AT5G19480NP_001031907.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22536
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.