DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MED19 and Med19

DIOPT Version :9

Sequence 1:NP_001287103.1 Gene:MED19 / 39987 FlyBaseID:FBgn0036761 Length:337 Species:Drosophila melanogaster
Sequence 2:NP_001101211.1 Gene:Med19 / 311165 RGDID:1311926 Length:244 Species:Rattus norvegicus


Alignment Length:222 Identity:99/222 - (44%)
Similarity:132/222 - (59%) Gaps:23/222 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 PKSSPHGGGRSPVVARQDSSGTLKTTISLGKTPTIIHTGPFYSMKEPPAKAELTGDKDLMTEYGL 76
            |...|.|||  |..|...::    |:..:|...:...:||||.|:|.|...||||..:|:|.|.|
  Rat    31 PPPPPPGGG--PGTAPPSTA----TSAPVGADKSTAGSGPFYLMRELPGSTELTGSTNLITHYNL 89

  Fly    77 HHTLTKFKEKKFKESLASFLQNIPGINDLI-THPVENSTLRSVIEKPPIGGKELLPLTPVQLAGF 140
            .....||..||.||.|::||.::||:.||. :|  :||:|||:||||||.|....|:|...|:||
  Rat    90 EQAYNKFCGKKVKEKLSNFLPDLPGMIDLPGSH--DNSSLRSLIEKPPILGGSFNPITGTMLSGF 152

  Fly   141 RLHPGPLPEQYRTTYVTPARKHKNKHKKQKHKDGVTTGQESTLLDSAGLET-YEKKH-KKQKRHE 203
            |||.||||||.|..::.|.:| ||||   |||       :|...|....|| .:..| ||:|:.|
  Rat   153 RLHTGPLPEQCRLMHIQPPKK-KNKH---KHK-------QSRTQDPVPPETPSDSDHKKKKKKKE 206

  Fly   204 DDKERKKRKKEKKRKKKNQSPE-PGVG 229
            :|.|||::|||||:||...||: ||:|
  Rat   207 EDPERKRKKKEKKKKKNRHSPDHPGMG 233

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MED19NP_001287103.1 Med19 50..202 CDD:287279 73/154 (47%)
Med19NP_001101211.1 Med19 63..233 CDD:287279 89/182 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166353472
Domainoid 1 1.000 151 1.000 Domainoid score I4261
eggNOG 1 0.900 - - E1_KOG4043
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 156 1.000 Inparanoid score I4201
OMA 1 1.010 - - QHG48661
OrthoDB 1 1.010 - - D1484317at2759
OrthoFinder 1 1.000 - - FOG0006079
OrthoInspector 1 1.000 - - oto98374
orthoMCL 1 0.900 - - OOG6_107921
Panther 1 1.100 - - LDO PTHR22536
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X4380
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1413.770

Return to query results.
Submit another query.