DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MED19 and MED19

DIOPT Version :9

Sequence 1:NP_001287103.1 Gene:MED19 / 39987 FlyBaseID:FBgn0036761 Length:337 Species:Drosophila melanogaster
Sequence 2:NP_001304007.2 Gene:MED19 / 219541 HGNCID:29600 Length:244 Species:Homo sapiens


Alignment Length:222 Identity:99/222 - (44%)
Similarity:128/222 - (57%) Gaps:23/222 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 PKSSPHGGGRSPVVARQDSSGTLKTTISLGKTPTIIHTGPFYSMKEPPAKAELTGDKDLMTEYGL 76
            |...|.|||  |..|...::.|...    |...:....||||.|:|.|...||||..:|:|.|.|
Human    31 PPPPPAGGG--PGTAPPPTAATAPP----GADKSGAGCGPFYLMRELPGSTELTGSTNLITHYNL 89

  Fly    77 HHTLTKFKEKKFKESLASFLQNIPGINDLI-THPVENSTLRSVIEKPPIGGKELLPLTPVQLAGF 140
            .....||..||.||.|::||.::||:.||. :|  :||:|||:||||||......|:|...||||
Human    90 EQAYNKFCGKKVKEKLSNFLPDLPGMIDLPGSH--DNSSLRSLIEKPPILSSSFNPITGTMLAGF 152

  Fly   141 RLHPGPLPEQYRTTYVTPARKHKNKHKKQKHKDGVTTGQESTLLDSAGLET-YEKKH-KKQKRHE 203
            |||.||||||.|..::.|.:| ||||   |||       :|...|....|| .:..| ||:|:.|
Human   153 RLHTGPLPEQCRLMHIQPPKK-KNKH---KHK-------QSRTQDPVPPETPSDSDHKKKKKKKE 206

  Fly   204 DDKERKKRKKEKKRKKKNQSPE-PGVG 229
            :|.|||::|||||:||...||: ||:|
Human   207 EDPERKRKKKEKKKKKNRHSPDHPGMG 233

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MED19NP_001287103.1 Med19 50..202 CDD:287279 73/154 (47%)
MED19NP_001304007.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..56 8/24 (33%)
Med19 63..233 CDD:287279 79/172 (46%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 171..244 31/74 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165159428
Domainoid 1 1.000 150 1.000 Domainoid score I4392
eggNOG 1 0.900 - - E1_KOG4043
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 151 1.000 Inparanoid score I4373
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG48661
OrthoDB 1 1.010 - - D1484317at2759
OrthoFinder 1 1.000 - - FOG0006079
OrthoInspector 1 1.000 - - oto91291
orthoMCL 1 0.900 - - OOG6_107921
Panther 1 1.100 - - LDO PTHR22536
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2633
SonicParanoid 1 1.000 - - X4380
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1514.800

Return to query results.
Submit another query.