DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5567 and NIPSNAP1

DIOPT Version :9

Sequence 1:NP_649015.2 Gene:CG5567 / 39986 FlyBaseID:FBgn0036760 Length:330 Species:Drosophila melanogaster
Sequence 2:NP_003625.2 Gene:NIPSNAP1 / 8508 HGNCID:7827 Length:284 Species:Homo sapiens


Alignment Length:190 Identity:36/190 - (18%)
Similarity:59/190 - (31%) Gaps:84/190 - (44%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 SRQAAINMYKQSCTNLLELSSAKVTEWLAGFDSVITD-------------CDGV----------- 49
            |::...|:||      ::..:.| .|:|..::| :|:             |..|           
Human    64 SKKETSNLYK------IQFHNVK-PEYLDAYNS-LTEAVLPKLHLDEDYPCSLVGNWNTWYGEQD 120

  Fly    50 ----LWIYGQALEGSVDVMNQLKGMGKSIYFCTNNSTKTRSELLKKGVELGFHIKENGIISTAHA 110
                ||.:.......:|.||:||...:.:.|     .:.||::|                     
Human   121 QAVHLWRFSGGYPALMDCMNKLKNNKEYLEF-----RRERSQML--------------------- 159

  Fly   111 TAAYLKRRNFSKRVFVIGSEGITKELDAVGIQHTEVGPEPMKG-SLAEFMAQHLKLDTDI 169
                |.|||.....|...:|                 |:|..| ::.|.....||..|.|
Human   160 ----LSRRNQLLLEFSFWNE-----------------PQPRMGPNIYELRTYKLKPGTMI 198

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5567NP_649015.2 PGP_euk 40..318 CDD:273635 29/159 (18%)
Hydrolase_6 42..142 CDD:290083 20/127 (16%)
Hydrolase_like 235..318 CDD:289983
NIPSNAP1NP_003625.2 NIPSNAP 185..282 CDD:285252 5/14 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R944
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.