DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5567 and CG5577

DIOPT Version :9

Sequence 1:NP_649015.2 Gene:CG5567 / 39986 FlyBaseID:FBgn0036760 Length:330 Species:Drosophila melanogaster
Sequence 2:NP_001303369.1 Gene:CG5577 / 39985 FlyBaseID:FBgn0036759 Length:315 Species:Drosophila melanogaster


Alignment Length:320 Identity:122/320 - (38%)
Similarity:176/320 - (55%) Gaps:24/320 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 MYKQSCTNLLELSSAKVTEWLAGFDSVITDCDGVLWIYGQALEGSVDVMNQLKG-MGKSIYFCTN 79
            |.:....:|..||..:|:|||..||:|:.|.||.:|....|:.|:.||:|.|:. ..|.:|..||
  Fly     1 MSRGGAIDLTGLSEEQVSEWLQSFDTVLCDGDGTIWQDDTAIAGAPDVVNALQDRFDKKVYLITN 65

  Fly    80 NSTKTRSELLKKGVELGFHI-KENGIISTAHATAAYL----KRRNFSKRVFVIGSEGITKELDAV 139
            |..|||.||.::...||||: .:..|||...|.|.||    |......:|:|:|:..|.:||...
  Fly    66 NGLKTRQELFERSQRLGFHLPSDRHIISPTAAIADYLVGSPKFDRTRHKVYVVGNAAIARELRQR 130

  Fly   140 GIQHTEVGPE---PMKGSLAEFMAQHL---KLDTDIGAVVVGFDEHFSFPKMMKAASYL-NDPEC 197
            ||.....|..   |......:|:.:..   :...|:||||||:||:||:.||.:|...| ::|:.
  Fly   131 GIDSYGAGGTDELPPGDKWPDFVTREFGNPEAAKDVGAVVVGWDEYFSYCKMARACHILCSNPDA 195

  Fly   198 LFVATNTDERFPMPNMIVPGSGSFVRAIQTCAERDPVVIGKPNPAICESLVTEKKIDPSRTLMIG 262
            .|:.||.|.....|:..:||:|:||..|:.|:||:.:.:|||||.:.|..:..:.:...||||||
  Fly   196 AFLVTNRDAVHKYPSFCIPGTGAFVAGIEACSEREALEMGKPNPLVLEPFIKAEGLRTERTLMIG 260

  Fly   263 DRANTDILLGFNCGFQTLLVGSG-IHQLKDV--ERWKLSQDPEEKKLIPDVYLPKLGDLL 319
            |....|:....|||..:||||:| .:.|.||  |:.:|.|        ||.|||:|||||
  Fly   261 DCLKIDVGFASNCGMLSLLVGTGRYNNLSDVRLEKDRLPQ--------PDFYLPRLGDLL 312

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5567NP_649015.2 PGP_euk 40..318 CDD:273635 110/293 (38%)
Hydrolase_6 42..142 CDD:290083 40/105 (38%)
Hydrolase_like 235..318 CDD:289983 35/85 (41%)
CG5577NP_001303369.1 PGP_euk 25..311 CDD:273635 110/293 (38%)
Hydrolase_6 27..132 CDD:290083 39/104 (38%)
Hydrolase_like 234..311 CDD:289983 35/84 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45469122
Domainoid 1 1.000 51 1.000 Domainoid score I4324
eggNOG 1 0.900 - - E1_COG0647
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 106 1.000 Inparanoid score I299
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG60740
OrthoDB 1 1.010 - - D337140at33208
OrthoFinder 1 1.000 - - FOG0000783
OrthoInspector 1 1.000 - - otm51381
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19288
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
109.910

Return to query results.
Submit another query.