DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5577 and CG10352

DIOPT Version :9

Sequence 1:NP_001303369.1 Gene:CG5577 / 39985 FlyBaseID:FBgn0036759 Length:315 Species:Drosophila melanogaster
Sequence 2:NP_001259468.1 Gene:CG10352 / 32147 FlyBaseID:FBgn0030348 Length:315 Species:Drosophila melanogaster


Alignment Length:318 Identity:97/318 - (30%)
Similarity:141/318 - (44%) Gaps:41/318 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LTGLSEEQVSEWLQSFDTVLCDGDGTIW---QDDTAIAGAPDVVNALQDRFDKKVYLITNNGLKT 70
            |..::|::..|:..|||.|.||.||.:|   :|  .|.|:.:.:..|. ...|.|..:|||.:.:
  Fly     7 LKNMTEKERDEFFDSFDLVFCDCDGVVWYPLRD--FIPGSAEALAHLA-HLGKDVTFVTNNSISS 68

  Fly    71 RQELFERSQRLGFHLPSDRH-IISPTAAIADYLVGSPKFDRTRHKVYVVGNAAIARELRQRGI-- 132
            .:|..|:.::.| ||..|.| |:.|...|.|:| .|.||:..   :|.:..:.....|...|.  
  Fly    69 VKEHIEKFEKQG-HLKIDEHQIVHPAQTICDHL-RSIKFEGL---IYCLATSPFKEILVNAGFRL 128

  Fly   133 -DSYGAGGTDELPPGDKWPDFVTREFGNPEA---AKDVGAVVVGWDEYFSYCKMARACHILCSNP 193
             ...|:|             .:||.....||   .:.|.||::..|...|..|:.|| |....||
  Fly   129 AQENGSG-------------IITRLKDLHEAIFSGESVDAVIIDVDFNLSAAKLMRA-HFQLQNP 179

  Fly   194 DAAFLVTNRDAVHKYPSFCIPGTGAFVAGIEACSEREALEMGKP----NPLVLEPFIKAEGLRTE 254
            ...||....||:..:....|.|.|||:..:.....|:.:.:|||    ..|:||   :...:...
  Fly   180 KCLFLAGAADALIPFGKGEIIGPGAFIDVVTQAVGRQPITLGKPGEDLRKLLLE---RHREIPPS 241

  Fly   255 RTLMIGDCLKIDVGFASNCGMLSLLVGTGRYNNLSDV-RLEKDRLPQPDFYLPRLGDL 311
            |.|.:||.|..|:|||...|..:|||.||. ..|.|| ||..|....||:....||.:
  Fly   242 RVLFVGDSLASDIGFARASGYQTLLVLTGG-TKLEDVQRLPIDHSQMPDYLADCLGQI 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5577NP_001303369.1 PGP_euk 25..311 CDD:273635 92/300 (31%)
Hydrolase_6 27..132 CDD:290083 32/108 (30%)
Hydrolase_like 234..311 CDD:289983 31/81 (38%)
CG10352NP_001259468.1 PGP_euk 23..296 CDD:273635 90/298 (30%)
Hydrolase_6 25..127 CDD:290083 33/109 (30%)
Hydrolase_like 220..293 CDD:289983 29/76 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45453854
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D337140at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm51381
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19288
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.950

Return to query results.
Submit another query.