DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5577 and Hdhd5

DIOPT Version :9

Sequence 1:NP_001303369.1 Gene:CG5577 / 39985 FlyBaseID:FBgn0036759 Length:315 Species:Drosophila melanogaster
Sequence 2:XP_006237308.2 Gene:Hdhd5 / 312680 RGDID:1306557 Length:423 Species:Rattus norvegicus


Alignment Length:346 Identity:72/346 - (20%)
Similarity:109/346 - (31%) Gaps:109/346 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 VLCDGDGTIWQDDTAIAGAPDVVNAL---QDRFDKKVYLITNNG-LKTRQELFERSQRLGFHLPS 87
            :|.|.||.:.:....|..|.:..:.|   |.:....|..:||.| :..|.:..|.|..|...:..
  Rat    49 LLFDIDGVLVRGHRVIPAALEAFSKLVNSQGQLQVPVVFVTNAGNILQRDKAQELSALLECKVDP 113

  Fly    88 DRHII--SPTAAIADYLVGSPKFDRTRHKVYVVGNAAIARELRQRGIDSYGAGGTDELPPGDKWP 150
            |:.|:  ||......|         ...::.|.|...:....|..|..:...  .|:|.......
  Rat   114 DQVILSHSPMKLFLQY---------HNKRMLVSGQGPLVENARALGFQNVVT--VDDLRIAFPEL 167

  Fly   151 DFV------------TREFGNPEAAKDVGAVVVG----WDEYFSYCKMARACHILCSN------- 192
            |.|            ||...:..|.:  |.:::|    |:     ..:.....:|.||       
  Rat   168 DMVDLQRRPKTMVIRTRPRSDFPAIE--GVLLLGEPVRWE-----TNLQLITDVLLSNGHPGAGL 225

  Fly   193 -----PDAAFLVTNRD----AVHKYPSFCIPGTGAFVAGIEACSER--------EALEMGKPNPL 240
                 |....|.:|.|    |....|.|   |.|.|:..:|....:        |.| ||||:.|
  Rat   226 ATAPYPHLPVLASNMDLLWMAEASMPRF---GHGTFLLCLETIYRKITGHELKYEGL-MGKPSIL 286

  Fly   241 V---LEPFIKAEGLR------TERTLMIGDCLKIDV----------------------------- 267
            .   .|..|:.:..|      ..:...|||....||                             
  Rat   287 TYRYAEEVIRQQAERRGWAAPIRKLYAIGDNPMSDVYGANLFHQYLQMANGGEKEQRADGQEKQR 351

  Fly   268 -GFASNCGMLSLLVGTGRYNN 287
             ..|.:|.  |:||.||.|::
  Rat   352 PSAARSCA--SVLVCTGIYSS 370

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5577NP_001303369.1 PGP_euk 25..311 CDD:273635 72/346 (21%)
Hydrolase_6 27..132 CDD:290083 24/110 (22%)
Hydrolase_like 234..311 CDD:289983 21/93 (23%)
Hdhd5XP_006237308.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0647
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.