DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5577 and CG2680

DIOPT Version :9

Sequence 1:NP_001303369.1 Gene:CG5577 / 39985 FlyBaseID:FBgn0036759 Length:315 Species:Drosophila melanogaster
Sequence 2:NP_570021.2 Gene:CG2680 / 31257 FlyBaseID:FBgn0024995 Length:305 Species:Drosophila melanogaster


Alignment Length:311 Identity:85/311 - (27%)
Similarity:138/311 - (44%) Gaps:27/311 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 LSEEQVSEWLQSFDTVLCDGDGTIWQDDTAIAGAPDVVNALQDRFDKKVYLITNNGLKTRQELFE 76
            ||.|:..:::.|||.|:.|.||.:|.....|......||||: ...|::..::||..::.::..|
  Fly    10 LSLEEQRQFIDSFDLVISDCDGVVWLLVGWIPNTGAAVNALK-AAGKQIKFVSNNSFRSEEDYME 73

  Fly    77 RSQRLGFHLPSDRHIISPTAAIADYLVGSPKFDRTRHKVYVVGNAAIARELRQRGIDSYGAGGTD 141
            :.:.:|.....:..|:.|...|..||    |..:...:||.:.:......||:..|:.......:
  Fly    74 KFRHIGAKNVQEDDIVHPVKTIVRYL----KKHKPGERVYSLMSLEANETLRKHNIEFESLQVKE 134

  Fly   142 ELPPGDKWPDFVTREFGNPEAAKDVGAVVVGWDEYFSYCKMARACHILCSNPDAAFLVTNRDAVH 206
            .|... ...|.:..|       |.||||:.......||.::|:|...|..|.|...:....|.:.
  Fly   135 HLTAA-SLVDHLAIE-------KPVGAVLFDIHLDLSYVELAKAIRHLQENDDCQLIAGGSDVIM 191

  Fly   207 KY-PSFCIPGTGAFVAGIEACSEREALEMGKPNPLVLEPFIKAEGLR-TERTLMIGDCLKIDVGF 269
            .. .:..:.|...|:..::..::|||..:|||:|::.|.|.:...:| .:|.:.|||.|..||.|
  Fly   192 PLAENLNVAGFFDFLEHVKRYTQREATFLGKPSPILGEMFGEMFEIRDCKRCIFIGDTLVQDVQF 256

  Fly   270 ASNCGMLSLLVGTGRYNNLSDVRLEKDRL-----PQPDFYLPRLGDLLNIL 315
            ...||..||||       ||....::|.|     .|||:|...|.|...:|
  Fly   257 GKACGFQSLLV-------LSGCLTKEDMLNAPVEAQPDYYADSLADFTQLL 300

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5577NP_001303369.1 PGP_euk 25..311 CDD:273635 78/292 (27%)
Hydrolase_6 27..132 CDD:290083 25/104 (24%)
Hydrolase_like 234..311 CDD:289983 30/82 (37%)
CG2680NP_570021.2 HAD-SF-IIA 25..270 CDD:273637 69/264 (26%)
Hydrolase_6 25..126 CDD:290083 25/105 (24%)
Hydrolase_like 220..295 CDD:289983 30/81 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45453849
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0647
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D337140at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19288
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.