DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Grd and srsx-31

DIOPT Version :9

Sequence 1:NP_524131.1 Gene:Grd / 39984 FlyBaseID:FBgn0001134 Length:686 Species:Drosophila melanogaster
Sequence 2:NP_001023767.1 Gene:srsx-31 / 3565162 WormBaseID:WBGene00008552 Length:308 Species:Caenorhabditis elegans


Alignment Length:31 Identity:7/31 - (22%)
Similarity:18/31 - (58%) Gaps:0/31 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   652 RIVFPLLFILINVFYWYGYLSRSSRILANTP 682
            :::||:.|....:.|.|.::..:::|:...|
 Worm   128 QLIFPITFTSALMIYGYQFIDYNTQIICMAP 158

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GrdNP_524131.1 Neur_chan_LBD 110..326 CDD:280998
LIC 111..670 CDD:273305 5/17 (29%)
Neur_chan_memb 398..667 CDD:280999 3/14 (21%)
srsx-31NP_001023767.1 TM helix 1 11..36 CDD:341315
7TM_GPCR_Srsx 19..277 CDD:255903 7/31 (23%)
TM helix 2 43..67 CDD:341315
TM helix 3 79..109 CDD:341315
TM helix 4 122..140 CDD:341315 3/11 (27%)
TM helix 5 165..190 CDD:341315
TM helix 6 201..230 CDD:341315
TM helix 7 241..266 CDD:341315
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3644
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.