powered by:
Protein Alignment Grd and srsx-31
DIOPT Version :9
Sequence 1: | NP_524131.1 |
Gene: | Grd / 39984 |
FlyBaseID: | FBgn0001134 |
Length: | 686 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001023767.1 |
Gene: | srsx-31 / 3565162 |
WormBaseID: | WBGene00008552 |
Length: | 308 |
Species: | Caenorhabditis elegans |
Alignment Length: | 31 |
Identity: | 7/31 - (22%) |
Similarity: | 18/31 - (58%) |
Gaps: | 0/31 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 652 RIVFPLLFILINVFYWYGYLSRSSRILANTP 682
:::||:.|....:.|.|.::..:::|:...|
Worm 128 QLIFPITFTSALMIYGYQFIDYNTQIICMAP 158
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG3644 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.