DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Grd and nAChRalpha3

DIOPT Version :9

Sequence 1:NP_524131.1 Gene:Grd / 39984 FlyBaseID:FBgn0001134 Length:686 Species:Drosophila melanogaster
Sequence 2:NP_001285015.1 Gene:nAChRalpha3 / 31767 FlyBaseID:FBgn0015519 Length:795 Species:Drosophila melanogaster


Alignment Length:379 Identity:83/379 - (21%)
Similarity:142/379 - (37%) Gaps:86/379 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    98 SWLTQSNNHANISELLDNLLRGYDNSIRPDFGGPPA-TIEVDIMVRSMGPISEVDMTYSMDCYFR 161
            |:::.|..:.:...|.|:||..|:..:||......| |:.:.:.:..:..::..:...:.:.:..
  Fly    15 SFISSSTANPDAKRLYDDLLSNYNKLVRPVVNVTDALTVRIKLKLSQLIDVNLKNQIMTTNLWVE 79

  Fly   162 QSWVDKRLAFEGAQDTLALSVSML----ARIWKPDTYFYNGKQSYLHTITTPNKFVRIYQNGRVL 222
            |||.|.:|.:|..:..   .|.||    ..||:||...||....... :|...|....| .|||.
  Fly    80 QSWYDYKLKWEPKEYG---GVEMLHVPSDHIWRPDIVLYNNADGNFE-VTLATKATLNY-TGRVE 139

  Fly   223 YSSRLTIKAGCPMNLADFPMDIQKCPLKFGSFGYTTSDVIYRWNKERPPVAIAE-DMKLSQFDLV 286
            :......|:.|.:::..||.|.|.|.:||||:.|....|..|...|.....:.| .:.||:|   
  Fly   140 WRPPAIYKSSCEIDVEYFPFDEQTCVMKFGSWTYDGFQVDLRHIDELNGTNVVEVGVDLSEF--- 201

  Fly   287 DCPAGNLTDIVYKAAAPRPQRRPFNNKDPPRPTSKVMTTFAGPAAKNQHVRGTGLKLDKGAFGTG 351
                       |                    ||........||.:|:            .|.|.
  Fly   202 -----------Y--------------------TSVEWDILEVPAVRNE------------KFYTC 223

  Fly   352 RDATGGSGSTTGLSGTITLETNHPSEYSMLMVNFHLQRHMGNFLIQVYGPCCLLVVLSWVSFWLN 416
            .|                      ..|..:..|..::|....:.:.:..||..:..|:.:.|:|.
  Fly   224 CD----------------------EPYLDITFNITMRRKTLFYTVNLIIPCMGISFLTILVFYLP 266

  Fly   417 REATADRVSLGITTVLTMTFLGLEARTDLPKVSYPTALDFFVFLSFGFIFATIL 470
            .: :.::|||.|:.:|::|...|.....:|    ||:|  .|.|...|:..|::
  Fly   267 SD-SGEKVSLSISILLSLTVFFLLLAEIIP----PTSL--VVPLLGKFVLFTMI 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GrdNP_524131.1 Neur_chan_LBD 110..326 CDD:280998 52/221 (24%)
LIC 111..670 CDD:273305 81/366 (22%)
Neur_chan_memb 398..667 CDD:280999 20/73 (27%)
nAChRalpha3NP_001285015.1 Neur_chan_LBD 26..241 CDD:280998 61/287 (21%)
Neur_chan_memb 248..>359 CDD:280999 20/73 (27%)
Neur_chan_memb <683..760 CDD:280999
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447334
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR18945
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.