DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Grd and LOC100333913

DIOPT Version :9

Sequence 1:NP_524131.1 Gene:Grd / 39984 FlyBaseID:FBgn0001134 Length:686 Species:Drosophila melanogaster
Sequence 2:XP_002666117.5 Gene:LOC100333913 / 100333913 -ID:- Length:175 Species:Danio rerio


Alignment Length:256 Identity:62/256 - (24%)
Similarity:102/256 - (39%) Gaps:90/256 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   434 MTFLGLEARTDLPKVSYPTALDFFVFLSFGFIFATILQFAVVHYYTKY-----GSGECYFIIEEL 493
            ||.|.:.||..||||:|.||:|:|:.:.:.|:|:.:::||.|:|:||.     |..|.    :|:
Zfish     1 MTTLSISARNSLPKVAYATAMDWFMAVCYAFVFSALIEFATVNYFTKRSWAWDGQKEA----QEM 61

  Fly   494 DSESGESETEPLTSDFR--GSTESKIYEVIPLSMCAISMPPPPTRLGMLTSRNRRPRNRRHGLWS 556
            ......|.::...:.|.  |:|                                         :|
Zfish    62 RRRESASFSKKTNNTFNIVGTT-----------------------------------------YS 85

  Fly   557 MKLLGLFDWRRRRKPPRADSDEDEDDEQTQLRANEAPTTSAAAAAAQAAAQAARISPPTGGRRRM 621
            |.::                   :|...|.:..:..||||               :||...|.  
Zfish    86 MSVV-------------------KDPGLTTISKSATPTTS---------------TPPQPVRE-- 114

  Fly   622 SYYRREEMEARRKGKRTPQYNSVSKIDRASRIVFPLLFILINVFYWYGYLSRSSRILANTP 682
              .|..:|:.....:....||.|||:|:.|||:||:||.:.|:.||..|::|...|..::|
Zfish   115 --VRLPKMDGEYVPEGRKSYNRVSKVDKISRIIFPVLFFIFNLGYWATYVNRKPTIERSSP 173

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GrdNP_524131.1 Neur_chan_LBD 110..326 CDD:280998
LIC 111..670 CDD:273305 58/242 (24%)
Neur_chan_memb 398..667 CDD:280999 56/239 (23%)
LOC100333913XP_002666117.5 Neur_chan_memb 1..158 CDD:308533 56/239 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1057372at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.