DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir75c and GLR2.6

DIOPT Version :9

Sequence 1:NP_649013.3 Gene:Ir75c / 39983 FlyBaseID:FBgn0261401 Length:623 Species:Drosophila melanogaster
Sequence 2:NP_001330285.1 Gene:GLR2.6 / 830988 AraportID:AT5G11180 Length:967 Species:Arabidopsis thaliana


Alignment Length:324 Identity:67/324 - (20%)
Similarity:125/324 - (38%) Gaps:57/324 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   320 VFLEPFMPSVWFAFAGLLIFAGVLLWMIFHLERHWMQRCLDFIPSLLSSCLISFGAACIQGSYLM 384
            |||:|....:||..|...::.|:::| ||..:.....|....|..:.:....||.....  :::.
plant   582 VFLKPLTRELWFLTAASFLYIGIMVW-IFEYQASGDFRKQSIINKISNVFYFSFSTLFF--AHMR 643

  Fly   385 P-KSAGGRLAFIAVMLTSFLMYNYYTSIVVSTLLGSPVRSNIRTIQQLADSSLDVGFDTVPFT-- 446
            | :|...|:..:.......::...||:.:.|.|....:|..:|.:..|.:|.:::|:.|..||  
plant   644 PSESIFTRVLVVVWCFVLLILTQSYTATLTSMLTVQELRPTVRHMDDLRNSGVNIGYQTGSFTFE 708

  Fly   447 ------------KTYLVSSPRPDIRSLYKQKVESKRDPNSVWLSPEEGVIRVRDQPGFVYTSEAS 499
                        |||  .:|: ::..|:.:|            |...|:....|:..:|    ..
plant   709 RLKQMGYKESRLKTY--DTPQ-EMHELFLKK------------SSNGGIDAAFDEVAYV----KL 754

  Fly   500 FMYHFVEKHYLPREISDLNEIILRPESAVYGMVHLNSTYRQLLTQL--QVRMLETGITSK--QSR 560
            ||..:..|:           .|:.|.....|..........|:..|  |:..:..|.|.|  :::
plant   755 FMAKYCSKY-----------TIIEPTFKADGFGFAFPLGSPLVPDLSRQILNITEGETMKAIENK 808

  Fly   561 FF--SKTKLHTFSNSFVIQVGMEYAAPLFISLLVAYFLALLILILEICWARYAKKKFSTIIPQN 622
            :.  .|..|.:.::...|::.......||..:.|...|.||.::  :| .||.::..|..|..|
plant   809 WLLGEKHCLDSTTSDSPIRLDHHSFEALFTIVFVVSMLLLLAML--VC-RRYRQESKSGEINAN 869

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ir75cNP_649013.3 Lig_chan 328..553 CDD:306551 45/241 (19%)
GLR2.6NP_001330285.1 PBP1_GABAb_receptor_plant 38..421 CDD:380645
GluR_Plant 460..810 CDD:270404 52/260 (20%)
Lig_chan 590..842 CDD:365843 53/284 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1052
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR18966
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.