DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir75c and GLR2.7

DIOPT Version :9

Sequence 1:NP_649013.3 Gene:Ir75c / 39983 FlyBaseID:FBgn0261401 Length:623 Species:Drosophila melanogaster
Sequence 2:NP_180476.3 Gene:GLR2.7 / 817460 AraportID:AT2G29120 Length:952 Species:Arabidopsis thaliana


Alignment Length:375 Identity:73/375 - (19%)
Similarity:135/375 - (36%) Gaps:81/375 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   250 LHYIWCGTWSVQDAFGGAIGMLTNESAELCTTPFVPSWNRLHYLHPMTEQAQFRAVCMFRTPHNA 314
            ::.::.|.:   ||..|.:.::.|.|.            .:.:..|.||.    .|.|. .|...
plant   526 VYQVYTGAY---DAVVGDVTIVANRSL------------YVDFTLPYTES----GVSMM-VPLKD 570

  Fly   315 GIKAAVFLEPFMPSVWFAFAGLLIFAGVLLWMIFHLERHWMQRCLDFIPSLLSSCLISFGAACIQ 379
            .....|||.|:...:|...|...:|.|.::|::.|...      .||..........||..|...
plant   571 NKNTWVFLRPWSLDLWVTTACFFVFIGFIVWILEHRVN------TDFRGPPHHQIGTSFWFAFST 629

  Fly   380 GSYLMPKSAGGRLAFIAVMLTSF---LMYNYYTSIVVSTLLGSPVRSNIRTIQQLADSSLDVGFD 441
            .::...:.....||...|::..|   ::...||:.:.|......::..:...:.|...:.::|:.
plant   630 MNFAHREKVVSNLARFVVLVWCFVVLVLIQSYTANLTSFFTVKLLQPTVTNWKDLIKFNKNIGYQ 694

  Fly   442 TVPFTKTYLVSSPRPDIRSLYKQK--VESKRDPNSVWLSPEE----GVIRVR-DQPGF--VYTSE 497
            ...|            :|.|.|.:  .||:..|....:..:|    |.|... |:..:  |..|:
plant   695 RGTF------------VRELLKSQGFDESQLKPFGSAVECDELFSNGTITASFDEVAYIKVILSQ 747

  Fly   498 ASFMYHFVEKHYLPREISDLNEIILRPESAVYGMVH------LNSTYRQLLTQLQVRMLETGITS 556
            .|..|..||..:               ::|.:|.|.      .:...|.:|...|...::    .
plant   748 NSSKYTMVEPSF---------------KTAGFGFVFPKKSPLTDDVSRAILNVTQGEEMQ----H 793

  Fly   557 KQSRFFSKTK----LHTFSNSFVIQVGMEYAAPLFISLLVAYFLALLILI 602
            .::::|.|..    |:|..:|..:.:...:.  ||:...:|.||||||.:
plant   794 IENKWFKKPNNCPDLNTSLSSNHLSLSSFWG--LFLIAGIASFLALLIFV 841

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ir75cNP_649013.3 Lig_chan 328..553 CDD:306551 43/242 (18%)
GLR2.7NP_180476.3 PBP1_GABAb_receptor 40..421 CDD:107361
ANF_receptor 54..405 CDD:279440
GluR_Plant 460..799 CDD:270404 59/329 (18%)
Lig_chan 584..832 CDD:278489 50/286 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1052
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR18966
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.