DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir75c and GLR2.2

DIOPT Version :9

Sequence 1:NP_649013.3 Gene:Ir75c / 39983 FlyBaseID:FBgn0261401 Length:623 Species:Drosophila melanogaster
Sequence 2:NP_180048.1 Gene:GLR2.2 / 817008 AraportID:AT2G24720 Length:920 Species:Arabidopsis thaliana


Alignment Length:212 Identity:41/212 - (19%)
Similarity:75/212 - (35%) Gaps:53/212 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   250 LHYIWCGTWSVQDAFGGAIGMLTNESAEL-CTTPFVPSWNRLHYLHPMTEQAQFRAVCMFRTPHN 313
            :|.::.|.:   ||..|...:|.|.|:.: .|.||:.|...|  :.|:.::.:       |...:
plant   522 VHQVYLGQF---DAVVGDTTILANRSSFVDFTLPFMKSGVGL--IVPLKDEVK-------RDKFS 574

  Fly   314 AGIKAAVFLEPFMPSVWFAFAGLLIFAGVLLWMIFHLER--------------HWMQ-RCLDFIP 363
                   ||:|....:|..........|:.:|.:.|...              .|.. ..:.|.|
plant   575 -------FLKPLSIELWLTTLVFFFLVGISVWTLEHRVNSDFRGPANYQASTIFWFAFSTMVFAP 632

  Fly   364 SLLSSCLISFGAACIQGSYLMPKSAGGRLAFIAVMLTSFLMYNYYTSIVVSTLLGSPVRSNIRTI 428
               ...::||||..:..::.          |:.::||     ..||:.:.|.|....:...|.::
plant   633 ---RERVLSFGARSLVVTWY----------FVLLVLT-----QSYTASLASLLTSQQLNPTITSM 679

  Fly   429 QQLADSSLDVGFDTVPF 445
            ..|......||:....|
plant   680 SSLLHRGETVGYQRTSF 696

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ir75cNP_649013.3 Lig_chan 328..553 CDD:306551 23/133 (17%)
GLR2.2NP_180048.1 PBP1_GABAb_receptor 33..412 CDD:107361
ANF_receptor 47..392 CDD:279440
HisJ 438..>587 CDD:223904 19/83 (23%)
GluR_Plant 452..801 CDD:270404 41/212 (19%)
Lig_chan 582..819 CDD:278489 23/133 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1052
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR18966
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.