DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir75c and Ir7f

DIOPT Version :9

Sequence 1:NP_649013.3 Gene:Ir75c / 39983 FlyBaseID:FBgn0261401 Length:623 Species:Drosophila melanogaster
Sequence 2:NP_001138177.1 Gene:Ir7f / 7354418 FlyBaseID:FBgn0259188 Length:621 Species:Drosophila melanogaster


Alignment Length:357 Identity:71/357 - (19%)
Similarity:127/357 - (35%) Gaps:119/357 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   307 MFRTP---HNAGIKAAVFLE------------PFMPSVWFAFAGLLIFAGVLLWMIFHLERHWMQ 356
            :..||   ::|.:.|.:.||            ||..|||..         :||.::.||..|   
  Fly   320 LLTTPMSYYSANLVAVLQLERYRIGSLALLVFPFELSVWML---------LLLALLIHLGIH--- 372

  Fly   357 RCLDFIPSL-----------LSSCLISFGAACIQGSYLMPKSAGGRLAFIAVMLTSFLMYNYYTS 410
                 :||.           |....:..|||..:    :|:|  .|..|||   ..:|..:....
  Fly   373 -----LPSARRGNEEDGGGGLQVVALLLGAALAR----LPRS--WRHRFIA---AHWLWASIPLR 423

  Fly   411 IVVSTLLGSPVRSNIRTIQQLA-DSSLDVGFDTVPFTKTYLVSSPRPDIRSLYKQKVESKRDPNS 474
            |...:||...:|..:......: |..|..||..:....|..:....|.:          .|||:|
  Fly   424 ISYQSLLFHLIRLQLYNTPSFSLDQLLAEGFQGICTANTQRLLLEMPQL----------ARDPDS 478

  Fly   475 V--------W-------LSPEEGVIRVRDQP---GFVYTSEASFMYHFVEK--------HYLPRE 513
            :        |       .:....:..|.:|.   .|:::|.....:|.|::        .|:|:.
  Fly   479 IQSVDTPFDWDVLNVLTRNRNRKIFAVANQDVTLSFLHSSAHPNAFHVVKQPVNVEYAGMYMPKH 543

  Fly   514 ---ISDLNEIILRPESAVYGMVHL--NSTYRQLLTQLQVRMLETGITSKQSRFFSKTKLHTFSNS 573
               ...:::.|.|.:::  |.:|.  .:::..:..:.||.|     ||:  |:.:..||   |..
  Fly   544 SFLYEKMDDDIRRLDAS--GFIHAWRRASFASVHRKEQVHM-----TSR--RYINHAKL---SGI 596

  Fly   574 FVIQVGMEYAAPLFISLLVAYFLALLILILEI 605
            :::..|:             |.||.|:...|:
  Fly   597 YMVMAGL-------------YLLAGLLFAGEV 615

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ir75cNP_649013.3 Lig_chan 328..553 CDD:306551 51/267 (19%)
Ir7fNP_001138177.1 Periplasmic_Binding_Protein_Type_2 231..>358 CDD:304360 9/37 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45462791
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1052
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.