DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir75c and grin2ab

DIOPT Version :9

Sequence 1:NP_649013.3 Gene:Ir75c / 39983 FlyBaseID:FBgn0261401 Length:623 Species:Drosophila melanogaster
Sequence 2:XP_009304490.1 Gene:grin2ab / 570493 ZFINID:ZDB-GENE-070424-223 Length:1445 Species:Danio rerio


Alignment Length:405 Identity:76/405 - (18%)
Similarity:124/405 - (30%) Gaps:149/405 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 VQNPDNLANVHKEYLDSDLVRLGVFLDLGCDKAELVTNQSSRARLYNQNLHWLLYD-EAGNFTKL 115
            |..|::.|:|..:.:.|.:    :.|....|:|.||..::....|......|::.. ..||...:
Zfish   198 VGEPEDRAHVQLKRIQSPV----ILLYCSKDEAALVMEEARSLGLTGAGFVWIVPSLTTGNLEHI 258

  Fly   116 TQLFEGANLSLNADVTYVSREDEERFILHDV---------------------------------- 146
            .:.|....:|    |||...:......|.|.                                  
Zfish   259 PEAFPAGMIS----VTYDEWDYPLETRLQDAVGIISSAAAAMFREEGRIPDGTASCYGQSEKPEV 319

  Fly   147 -------YNKGSHLGGKLNITVDQTLQCN--------------------RSHCQVKEYLSELHLR 184
                   |..|.:||||.:..:|...|.|                    .:|        .|.|:
Zfish   320 PPSALRRYMMGVNLGGKDHSFMDDGYQVNPKLVVIVLNTEREWEKMGRWENH--------SLRLK 376

  Fly   185 ----PRLQHRMD-------LSSVTFRLAALVSV--------------LPINSSEEELLEFLNSDR 224
                ||.....|       ||.||......|.|              :|.....::     |:..
Zfish   377 FPVWPRYNSFGDMDADENHLSIVTLEERPFVIVDDVDILTGTCMRNSVPCRKHIKD-----NTTE 436

  Fly   225 DSH---------MDSISRIGNRLIMHTQEIL-------GFKLHYIWCGTWS--VQDAFGGAIGML 271
            .|:         :|.:.:|. |.:..|.::.       |.|::.:|.|...  |......|:|.|
Zfish   437 GSYVKKCCKGFCIDILKKIA-RNVKFTYDLYLVTNGKHGKKINNVWNGMVGEVVYKKAVMAVGSL 500

  Fly   272 T--NESAELC--TTPFVPSWNRLHYLHPMTEQAQFRAVCMFRTPHNAGIKAAVFLEPFMPSVW-F 331
            |  .|.:|..  :.|||.:                 .:.:..:..|..:..:.|||||..||| .
Zfish   501 TINEERSEAIDFSVPFVET-----------------GISVMVSRSNGTVSPSAFLEPFSASVWVM 548

  Fly   332 AFAGLLIFAGVLLWM 346
            .|..|||...:.:::
Zfish   549 MFVMLLIVTAIAVFL 563

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ir75cNP_649013.3 Lig_chan 328..553 CDD:306551 7/20 (35%)
grin2abXP_009304490.1 PBP1_iGluR_NMDA_NR2 25..382 CDD:107373 33/199 (17%)
ANF_receptor 48..358 CDD:279440 30/167 (18%)
PBP2_iGluR_NMDA_Nr2 393..790 CDD:270436 40/194 (21%)
Lig_chan 544..816 CDD:278489 7/20 (35%)
NMDAR2_C 827..1445 CDD:287527
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170591194
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.