DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir75c and grik1b

DIOPT Version :9

Sequence 1:NP_649013.3 Gene:Ir75c / 39983 FlyBaseID:FBgn0261401 Length:623 Species:Drosophila melanogaster
Sequence 2:XP_690040.5 Gene:grik1b / 561540 ZFINID:ZDB-GENE-070821-1 Length:906 Species:Danio rerio


Alignment Length:429 Identity:88/429 - (20%)
Similarity:154/429 - (35%) Gaps:110/429 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   238 LIMHTQEILGF--KLHYIWCGTWSVQDAFG---GAIGMLTNESAELCTTPFVPSWNR---LHYLH 294
            |:.....||||  ::..:..|.:..|:..|   |.:..|.:..|:|...|...::.|   :.:..
Zfish   507 LLKELSNILGFSYEVKLVTDGKYGAQNDKGEWNGMVRELIDHVADLAVAPLTITYVREKVIDFSK 571

  Fly   295 P-MTEQAQFRAVCMFRTPHNAGIKAAVFLEPFMPSVWFAFAGLLIFAGVLLWMIFHLERHWMQRC 358
            | ||    .....::..|:........||.|..|.:|...  ||...||.. ::|.:.|      
Zfish   572 PFMT----LGISILYHKPNGTNPGVFSFLNPLSPDIWMYV--LLACLGVSC-VLFVIAR------ 623

  Fly   359 LDFIP--------------------SLLSSCLISFGAACIQGSYLMPKSAGGRLA------FIAV 397
              |.|                    :|::|.....||...|||.||||:...|:.      |..:
Zfish   624 --FTPYEWYNPHPCNPDSDVVENNFTLINSVWFGVGALMQQGSELMPKALSTRIVGGIWWFFTLI 686

  Fly   398 MLTSFLMYNYYTSIVVSTLLGSPVRSNIRTIQQLADSSLDVGFDTVPFTK-TYLVSSPRPDIRSL 461
            :::|      ||:.:.:.|          |:::: ||.:|...|....|| .|........:...
Zfish   687 IISS------YTANLAAFL----------TVERM-DSPIDSADDLAKQTKIEYGAVRDGSTMTFF 734

  Fly   462 YKQKVE---------SKRDPNSVWLSPEEGVIRVRDQPGFVYTSEASFMYHFVEKHYLPREISDL 517
            .|.|:.         |.|...::..:..||:.|       |.|::.:.:.......|:.:...:|
Zfish   735 KKSKISTYEKMWAFMSSRKNTALVKNNREGIQR-------VLTTDYALLMESTSIEYISQRNCNL 792

  Fly   518 NEIILRPESAVYGM-VHLNSTYRQLLTQLQVRMLETGITSKQSRFFSKTKLHTFSNSF------- 574
            .:|....:|..||: ..:.|.||..:|...:::.|.|            |||.....:       
Zfish   793 TQIGGLIDSKGYGVGTPIGSPYRDKVTIAILQLQEEG------------KLHMMKEKWWRGNGCP 845

  Fly   575 ------VIQVGMEYAAPLFISLLVAYFLALLILILEICW 607
                  ...:|:|....:||.|.....|::.:.|.|..:
Zfish   846 EEDSKEASALGVENIGGIFIVLAAGLVLSVFVAIGEFIY 884

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ir75cNP_649013.3 Lig_chan 328..553 CDD:306551 54/261 (21%)
grik1bXP_690040.5 Periplasmic_Binding_Protein_Type_1 62..455 CDD:299141
ANF_receptor 80..423 CDD:279440
Periplasmic_Binding_Protein_Type_2 471..840 CDD:304360 80/383 (21%)
Lig_chan 602..871 CDD:278489 63/315 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170591208
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.