DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir75c and Ir68b

DIOPT Version :9

Sequence 1:NP_649013.3 Gene:Ir75c / 39983 FlyBaseID:FBgn0261401 Length:623 Species:Drosophila melanogaster
Sequence 2:NP_648548.1 Gene:Ir68b / 39378 FlyBaseID:FBgn0036250 Length:635 Species:Drosophila melanogaster


Alignment Length:287 Identity:59/287 - (20%)
Similarity:101/287 - (35%) Gaps:64/287 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   257 TWSVQDAFGGAIGMLTNESAELCTTPFVPS--------WNRLHYLHPMTEQAQFRAVCMFRTPHN 313
            |..|.|..||             .|.|.|:        |..:..|:|.|.:.....|     |.:
  Fly   255 TGVVSDIVGG-------------HTHFAPNSRFVLDCIWPAVEVLYPYTRRNLHLVV-----PAS 301

  Fly   314 A-GIKAAVFLEPFMPSVWFAFAGLLIFAGVLLWMIFHLERHWMQRCLDFIPSLLSSCLISFGAAC 377
            | ..:..:|:..|..:||:.....|:...::.|::..|:|...:|.:....:.....|..||...
  Fly   302 AIQPEYLIFVRVFRRTVWYLLLVTLLVVVLVFWVMQRLQRRIPRRGVIQFQATWYEILEMFGKTH 366

  Fly   378 IQGSYLMPKSAGGRLAFIAVMLTSFLMYNYYTSIVVSTLLGSPVRSNIRTIQQLADSSLDVGFDT 442
            :       ....|||:..:.|.| |||.....|.|:||:..:.:.|..  ::...:..:|...|.
  Fly   367 V-------GEPAGRLSSFSSMRT-FLMGWILFSYVLSTIYFAKLESGF--VRPSYEEQVDRVDDL 421

  Fly   443 VPF-TKTYLVSSPRPDIRSL-----------------------YKQKVESKRDPNSVWLSPEEGV 483
            |.. ...|.|::....:||.                       |.|.|..:||..:.::..:   
  Fly   422 VHLDVHIYAVTTMYDAVRSALTEHQYGLLENRSRQLPLGIATSYYQPVVRRRDRRAAFIMRD--- 483

  Fly   484 IRVRDQPGFVYTSEASFMYHFVEKHYL 510
            ...||.....|.|:|....:.:.:.||
  Fly   484 FHARDFLAITYDSQAERPAYHIAREYL 510

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ir75cNP_649013.3 Lig_chan 328..553 CDD:306551 42/207 (20%)
Ir68bNP_648548.1 Lig_chan 333..607 CDD:278489 39/191 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45462811
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.