DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir75c and Ir7c

DIOPT Version :9

Sequence 1:NP_649013.3 Gene:Ir75c / 39983 FlyBaseID:FBgn0261401 Length:623 Species:Drosophila melanogaster
Sequence 2:NP_001245572.1 Gene:Ir7c / 31692 FlyBaseID:FBgn0029966 Length:625 Species:Drosophila melanogaster


Alignment Length:397 Identity:79/397 - (19%)
Similarity:146/397 - (36%) Gaps:97/397 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   264 FGGAIGMLTNESAELCTTPFVPSWNRLHYLHPMTEQAQFRAVCMFRTPHNAGIKAAVFL-EPFMP 327
            |.|.:.|:.:....|....|:.|..|...:.|.|....|..|.:  .|....|.....| .||..
  Fly   279 FTGILKMMVDGEVNLTFVCFMYSKARSDLMLPSTSYTSFPIVLV--VPSGGSISPMGRLTRPFRY 341

  Fly   328 SVWFAFAGLLIFAGVLLWMIFHLERHWMQRCLDFIPSLLSSCL--------ISFGAACIQGSYLM 384
            .:|......|||..||:.::          .:..:|.|.:..|        :...|:.:.|..|.
  Fly   342 IIWSCILVSLIFGFVLICLL----------KITALPGLRNLVLGRRNRLPFMGMWASLLGGLALY 396

  Fly   385 -PKSAGGRLAFIAVMLTSFLMYNYYTSIVVSTLLGSPVRSNIRTIQQLADSSLDVGFDTVPFTKT 448
             |:....|...:..:|.:.::...||..:...|....:||.|:::.::.  :.|..|..:|..:|
  Fly   397 NPQRNFARYILVMWLLQTLILRAAYTGQLYLLLQDVEMRSPIKSLSEVL--AKDYEFRILPALRT 459

  Fly   449 -YLVSSPRPDIRSLYKQKVESKRDPNSVWLSPEEGVIRVRDQ--PG------------FVYTSEA 498
             :..|.|..:..::               ||.||.:.|:||:  ||            |.:.|..
  Fly   460 IFKDSMPTTNFHAV---------------LSLEESLYRLRDEDDPGITVALLQPTVNQFDFRSGP 509

  Fly   499 SFMYHFVEKHYLPREISDLNEIILRPESAVYGMVHLNSTYRQLLTQLQVRMLETGITSKQSRFF- 562
            :           .|.::.|.:.::......|...|  |.:::.:.:|.:.|:.:||.::..:.: 
  Fly   510 N-----------KRHLTVLPDPLMTAPLTFYMRPH--SYFKRRIDRLIMAMMSSGIVARYRKMYM 561

  Fly   563 ------SKTK--------LHTFSNSFVIQVGMEYAAPLFISLLVAYFLALLILILEICWA--RYA 611
                  ||.:        :...|..||...|:             |.:||::.||||...  |..
  Fly   562 DRIKRVSKRRNLEPKPLSIWRLSGIFVCCAGL-------------YLVALIVFILEILTTNHRRL 613

  Fly   612 KKKFSTI 618
            ::.|:.|
  Fly   614 RRAFNVI 620

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ir75cNP_649013.3 Lig_chan 328..553 CDD:306551 45/248 (18%)
Ir7cNP_001245572.1 Lig_chan-Glu_bd 225..287 CDD:214911 3/7 (43%)
Lig_chan 343..593 CDD:278489 52/289 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45462769
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1052
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.