DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir75c and W02A2.5

DIOPT Version :9

Sequence 1:NP_649013.3 Gene:Ir75c / 39983 FlyBaseID:FBgn0261401 Length:623 Species:Drosophila melanogaster
Sequence 2:NP_502564.2 Gene:W02A2.5 / 189098 WormBaseID:WBGene00012190 Length:487 Species:Caenorhabditis elegans


Alignment Length:177 Identity:38/177 - (21%)
Similarity:65/177 - (36%) Gaps:44/177 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   256 GTWSVQDAFGGAIGMLTNESAELCTTPFVPSWNR---LHYLHPMTE-QAQFRAVCMFRTPHNAGI 316
            ||||      |.:|.|.|.:|:.....:..:..|   ..|.:|:|. |..|  |...:|.....:
 Worm    76 GTWS------GVLGYLQNGTADAVALMYQKTDTRNEYFEYSYPVTNVQPVF--VARKKTETLGSV 132

  Fly   317 KAAVFLEPFMPSVWFAFAGLLI--------FAGV--------------LLWMIFHLERHWMQRCL 359
            ....| :||...||......|:        .:|:              :||.:..|:..  ::..
 Worm   133 LWNAF-KPFSVEVWLCLLASLVLNLLIMIAISGIEFKLLFRSRFRPWEMLWHVVQLQLD--EKSD 194

  Fly   360 DFIPSLLSSCLISFGAACIQGSYLMPKSAGGRLAFIAVMLTSFLMYN 406
            |.:...||..::.|..|.:|...|:....|       ::||:.:..|
 Worm   195 DMLFYTLSGNIVLFVFALLQSGILIEVYKG-------MLLTALITSN 234

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ir75cNP_649013.3 Lig_chan 328..553 CDD:306551 18/101 (18%)
W02A2.5NP_502564.2 Lig_chan-Glu_bd <36..86 CDD:214911 6/15 (40%)
Periplasmic_Binding_Protein_Type_2 <74..>124 CDD:304360 16/55 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1052
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.