DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir75c and grin2ca

DIOPT Version :9

Sequence 1:NP_649013.3 Gene:Ir75c / 39983 FlyBaseID:FBgn0261401 Length:623 Species:Drosophila melanogaster
Sequence 2:NP_001352716.1 Gene:grin2ca / 100003342 ZFINID:ZDB-GENE-070822-3 Length:1400 Species:Danio rerio


Alignment Length:411 Identity:82/411 - (19%)
Similarity:145/411 - (35%) Gaps:130/411 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   267 AIGMLT--NESAELC--TTPFVPSWNRLHYLHPMTEQAQFRAVCMFRTPHNAGIKAAVFLEPFMP 327
            |||.||  .|.:|:.  :.|||.:                 .:.:.....|..:..:.||||:.|
Zfish   516 AIGSLTINEERSEIIDFSVPFVET-----------------GISVMVARSNGTVSPSAFLEPYSP 563

  Fly   328 SVW-FAFAGLLIFAGVLLWMIFHLERHWMQRC--LDFIPSLLS-------------SCLISFG-- 374
            :|| ..|...|....|.:::        .:.|  :.:..||:|             |..:.:|  
Zfish   564 AVWVMMFVMCLTVVAVTVFV--------FEYCSPVGYNRSLVSAKDPGGPTFTIGKSVWLLWGIV 620

  Fly   375 ---AACIQGSYLMPKSAGGRL-----AFIAVM--------LTSFLMYNYYTSIVVSTLLGSPVRS 423
               :..|:.    ||....::     ||.||:        |.:|::...|    :.|:.|    .
Zfish   621 FNNSVPIEN----PKGTTSKIMVLVWAFFAVIFLASYTANLAAFMIQEQY----IDTVSG----L 673

  Fly   424 NIRTIQQLADSSLDVGFDTVPFTKTYL-VSSPRPDIRS---LYKQKVESKRDPNSVWLSPEEGVI 484
            :.:..|:..|......|.|||...|.. :.|..|::.|   .|.||                   
Zfish   674 SDKKFQKPQDQYPPFRFGTVPNGSTERNIRSNYPEMHSHMVKYNQK------------------- 719

  Fly   485 RVRDQPGFVYTSEA-SFMYHFVEKHYLPREISDLNEIILRP----ESAVYGM-VHLNSTYR---- 539
            .|.|....:.|.:. :|:|.....:|:..:......:.:..    .:..||: :...|.::    
Zfish   720 GVEDALNSLKTGKLDAFIYDAAVLNYMAGKDEGCKLVTIGSGKVFATTGYGIALQKESRWKRPID 784

  Fly   540 ----QLLTQLQVRMLE----TGITSKQSRFFSKTKLHTFSNSFVIQVGMEYAAPLFISLLVAYFL 596
                |.|.....:.|:    |||...:.:....:||           .::..|.:|..||||..|
Zfish   785 LALLQFLADGDTQKLQTVWLTGICRNEKKEVMSSKL-----------DIDNMAGVFYMLLVAMGL 838

  Fly   597 ALLILILE--ICW-ARYAKKK 614
            :||:...|  :.| .|::.:|
Zfish   839 SLLVFAWEHLLYWKLRHSVRK 859

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ir75cNP_649013.3 Lig_chan 328..553 CDD:306551 48/280 (17%)
grin2caNP_001352716.1 PBP1_iGluR_NMDA_NR2 38..398 CDD:107373
PBP2_iGluR_NMDA_Nr2 409..810 CDD:270436 67/349 (19%)
NMDAR2_C 847..>938 CDD:313729 3/13 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170591239
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1052
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.