DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir75a and GLR3.4

DIOPT Version :9

Sequence 1:NP_649012.2 Gene:Ir75a / 39982 FlyBaseID:FBgn0036757 Length:629 Species:Drosophila melanogaster
Sequence 2:NP_001030971.1 Gene:GLR3.4 / 839268 AraportID:AT1G05200 Length:959 Species:Arabidopsis thaliana


Alignment Length:365 Identity:79/365 - (21%)
Similarity:138/365 - (37%) Gaps:57/365 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   276 VGAVVDQTADLTATPSLATEGRLKYL---SAIIETGFFRSVCIFRTPHNAGLRGDVFLQPFSPLV 337
            |..||....|:..........|.:|:   ...||:|    :.:......|......||:||:..:
plant   556 VNEVVADNFDVAVGDITIVTNRTRYVDFTQPFIESG----LVVVAPVKEAKSSPWSFLKPFTIEM 616

  Fly   338 WYLFGGVLSLIGVLLWITFYMECKRMQKRWRLDYLPSLLSTFLISFGAACIQSSSLIPRSAGGRL 402
            |.:.||....:|.::||..:    |..:.:|......|::.|..||.............|.|..:
plant   617 WAVTGGFFLFVGAMVWILEH----RFNQEFRGPPRRQLITIFWFSFSTMFFSHRENTVSSLGRFV 677

  Fly   403 IYFALFLISFIMYNYYTSVVVSSLLSSPVKSKIKTMRQLAESSLTVGLEPLPFTKSYLNYSRLPE 467
            :...||:: .|:.:.||:.:.|.|....:.|:|:.:..|..|:..:|::...|.::||    :.|
plant   678 LIIWLFVV-LIINSSYTASLTSILTIRQLTSRIEGIDSLVTSNEPIGVQDGTFARNYL----INE 737

  Fly   468 IHLFIKRKIESQTQNPELWLPAEQ------GVLRVRDNPGYVYVFETSSGYAYVERYFTAQEICD 526
            :::...|.:  ..::.|.:|.|.|      ||..:.|...|:.|..|:|.             |.
plant   738 LNILPSRIV--PLKDEEQYLSALQRGPNAGGVAAIVDELPYIEVLLTNSN-------------CK 787

  Fly   527 LNEVLFRPEQLFYTH------LHRNSTYKELFRLRFLRILETGVYRKQRSYWVHMKLHCVAQNFV 585
                 ||.....:|.      ..|:|..........|::.|.|...|....|::.|..|..|   
plant   788 -----FRTVGQEFTRTGWGFAFQRDSPLAVDMSTAILQLSEEGELEKIHRKWLNYKHECSMQ--- 844

  Fly   586 ITVGMEYVAPLL----LMLICADILVVVILLVELAWKRFF 621
            |:...:....|.    |.|||.  :...:.|....|:.|:
plant   845 ISNSEDSQLSLKSFWGLFLICG--ITCFMALTVFFWRVFW 882

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ir75aNP_649012.2 Lig_chan 337..603 CDD:306551 61/281 (22%)
GLR3.4NP_001030971.1 PBP1_GABAb_receptor_plant 62..450 CDD:380645
Periplasmic_Binding_Protein_Type_2 <518..591 CDD:389745 8/34 (24%)
Lig_chan 615..869 CDD:365843 62/287 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1052
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR18966
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.