DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir75a and GLR2.1

DIOPT Version :9

Sequence 1:NP_649012.2 Gene:Ir75a / 39982 FlyBaseID:FBgn0036757 Length:629 Species:Drosophila melanogaster
Sequence 2:NP_198062.2 Gene:GLR2.1 / 832768 AraportID:AT5G27100 Length:901 Species:Arabidopsis thaliana


Alignment Length:317 Identity:61/317 - (19%)
Similarity:109/317 - (34%) Gaps:80/317 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   274 GSVGAVVDQTADLTATPSLATEGRLKYLSAIIETGFFRSVCIFRTPHNAGL----------RGDV 328
            |...|||..|. :::..|:..:..|.|                 ||...||          ...:
plant   522 GKYDAVVADTT-ISSNRSMYVDFSLPY-----------------TPSGVGLVVPVKDSVRRSSTI 568

  Fly   329 FLQPFSPLVWYLFGGVLS--LIGVLLWITFYMECKRMQKRWRLDY----LPSLLSTFLISFGAAC 387
            ||.|.:..:|.:  .:||  :||:::|:        ::.|...|:    ...|.:.|..||....
plant   569 FLMPLTLALWLI--SLLSFFIIGLVVWV--------LEHRVNPDFDGPGQYQLSTIFWFSFSIMV 623

  Fly   388 IQSSSLIPR----SAGGRLIYFALFLISFIMYNYYTSVVVSSLLSSPVKSKIKTMRQLAESSLTV 448
                 ..||    |...|::....:.:..::...||:.:.|.|.:..:...:..:..|.....:|
plant   624 -----FAPRERVLSFWARVVVIIWYFLVLVLTQSYTASLASLLTTQHLHPTVTNINSLLAKGESV 683

  Fly   449 GLEPLPFTKSYLNYSRLPEIHLFIKRKIE------SQTQNPELWLPAEQGVLRVRDNPGYVYVF- 506
            |.:. .|....|..|...|..|......|      |:.|       ||.||..|.....||.:| 
plant   684 GYQS-SFILGRLRDSGFSEASLVSYGSPEHCDALLSKGQ-------AEGGVSAVLMEVPYVRIFL 740

  Fly   507 -ETSSGYAYVERYFTAQE-----------ICDLNEVLFRPEQLFYTHLHRNSTYKEL 551
             :..:.|..|:..|....           :.|::..:.:.|:....:...|:.:|.:
plant   741 GQYCNKYKMVQTPFKVDGLGFVFPIGSPLVADISRAILKVEESNKANQLENAWFKPI 797

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ir75aNP_649012.2 Lig_chan 337..603 CDD:306551 46/244 (19%)
GLR2.1NP_198062.2 PBP1_GABAb_receptor 49..411 CDD:107361
ANF_receptor 49..392 CDD:279440
GluR_Plant 452..794 CDD:270404 60/312 (19%)
Periplasmic_Binding_Protein_Type_2 478..>685 CDD:304360 37/195 (19%)
Lig_chan 576..835 CDD:278489 46/245 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1052
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR18966
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.