DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir75a and GLR2.6

DIOPT Version :9

Sequence 1:NP_649012.2 Gene:Ir75a / 39982 FlyBaseID:FBgn0036757 Length:629 Species:Drosophila melanogaster
Sequence 2:NP_001330285.1 Gene:GLR2.6 / 830988 AraportID:AT5G11180 Length:967 Species:Arabidopsis thaliana


Alignment Length:363 Identity:76/363 - (20%)
Similarity:132/363 - (36%) Gaps:85/363 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   277 GAVVDQTADLTATPSLATEGRLKYLSAIIETGFFRSVCIFRTPHNAGLRGD-VFLQPFSPLVWYL 340
            |||.|.|  :.|..|...:..|.|    .|||    :.:.....:...:|. |||:|.:..:|:|
plant   540 GAVGDTT--ILANRSTYVDFALPY----SETG----IVVVVPVKDEREKGKWVFLKPLTRELWFL 594

  Fly   341 FGGVLSLIGVLLWITFYMECKRMQKRWRLDYLPSLLSTFLISFG----AACIQSSSLIPRSAGGR 401
            .......||:::||..|......:|:   ..:..:.:.|..||.    |....|.|:..|.    
plant   595 TAASFLYIGIMVWIFEYQASGDFRKQ---SIINKISNVFYFSFSTLFFAHMRPSESIFTRV---- 652

  Fly   402 LIYFALFLISFIMYNYYTSVVVSSLLSSPVKSKIKTMRQLAESSLTVGLEPLPFTKSYL------ 460
            |:....|:: .|:...||:.:.|.|....::..::.|..|..|.:.:|.:...||...|      
plant   653 LVVVWCFVL-LILTQSYTATLTSMLTVQELRPTVRHMDDLRNSGVNIGYQTGSFTFERLKQMGYK 716

  Fly   461 -----NYSRLPEIH-LFIKRKIESQTQNPELWLPAEQGVLRVRDNPGYVYVFETSSGYAYVERYF 519
                 .|....|:| ||:|:.             :..|:....|...||.:|...    |..:| 
plant   717 ESRLKTYDTPQEMHELFLKKS-------------SNGGIDAAFDEVAYVKLFMAK----YCSKY- 763

  Fly   520 TAQEICDLNEVLFRPEQLFYTHLHRNSTYKELFRLRFLRILETGVYRKQRSYWVHMKLHCVAQN- 583
                  .:.|..|:.:...:.....:....:|.| :.|.|.|....:...:.|:..:.||:... 
plant   764 ------TIIEPTFKADGFGFAFPLGSPLVPDLSR-QILNITEGETMKAIENKWLLGEKHCLDSTT 821

  Fly   584 -------------------FVITVGMEYVAPLLLMLIC 602
                               ||:::.:     ||.||:|
plant   822 SDSPIRLDHHSFEALFTIVFVVSMLL-----LLAMLVC 854

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ir75aNP_649012.2 Lig_chan 337..603 CDD:306551 59/302 (20%)
GLR2.6NP_001330285.1 PBP1_GABAb_receptor_plant 38..421 CDD:380645
GluR_Plant 460..810 CDD:270404 66/312 (21%)
Lig_chan 590..842 CDD:365843 52/284 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1052
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR18966
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.