DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir75a and GLR2.8

DIOPT Version :9

Sequence 1:NP_649012.2 Gene:Ir75a / 39982 FlyBaseID:FBgn0036757 Length:629 Species:Drosophila melanogaster
Sequence 2:NP_001324459.1 Gene:GLR2.8 / 817459 AraportID:AT2G29110 Length:948 Species:Arabidopsis thaliana


Alignment Length:462 Identity:88/462 - (19%)
Similarity:152/462 - (32%) Gaps:132/462 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   114 SKLEFYDLFGLFNISIDADVSYVKEQIQDNNDSVAYAVHDVYNNGKIIG------GQLNVTGSHE 172
            |::.|..|.|.||: ||..:...|.:|          ::.|.|..:|:|      |.:||..:..
plant   370 SEIRFNGLAGRFNL-IDRQLESPKFEI----------INFVGNEERIVGFWTPSNGLVNVNSNKT 423

  Fly   173 MSCDPFVCRRTRHL-----SSL-------------------QKRSKYGNREQLTDVVLRVAT--- 210
            .|   |...|...|     |::                   .|:..:...|.:||.:..:.|   
plant   424 TS---FTGERFGPLIWPGKSTIVPKGWEIPTNGKKIKVGVPVKKGFFNFVEVITDPITNITTPKG 485

  Fly   211 --------VVTQRPLTLSDDELIRFLSQENDTHIDSLARFGFHLTLILRDLLHCKMKFIFSDSWS 267
                    .:.:.|.::. .:..||.|.::|                            :.|...
plant   486 YAIDIFEAALKKLPYSVI-PQYYRFESPDDD----------------------------YDDLVY 521

  Fly   268 KSDVVGGSVGAVVDQTADLTATPSLATEGRLKYLSAIIETGFFRSVCIFRTPHNAGLRGDVFLQP 332
            |.|  .|::.|||.... :||..||..:..|.|    .|:|....|.:   ..|......|||:|
plant   522 KVD--NGTLDAVVGDVT-ITAYRSLYADFTLPY----TESGVSMMVPV---RDNENKNTWVFLKP 576

  Fly   333 FSPLVWYLFGGVLSLIGVLLWITFYMECKRMQKRWRLDYL----PSLLSTFLISFGAACIQSSSL 393
            :...:|........|||.::|:        .:.|...|:.    ..:.::|..||..........
plant   577 WGLDLWVTTACFFVLIGFVVWL--------FEHRVNTDFRGPPHHQIGTSFWFSFSTMVFAHREK 633

  Fly   394 IPRSAGGRLIYFALFLISFIMYNYYTSVVVSSLLSSPVKSKIKTMRQLAESSLTVGLEPLPFTKS 458
            :..:. .|.:......:..::...||:.:.|.|.....:.....::.|.::...||.:...|.|.
plant   634 VVSNL-ARFVVVVWCFVVLVLTQSYTANLTSFLTVQRFQPAAINVKDLIKNGDYVGYQHGAFVKD 697

  Fly   459 YL-----NYSRL------PEIHLFIKRKIESQTQNPELWLPAEQGVLRVRDNPGYVYVFETSSGY 512
            :|     |.|:|      .|.|..:.....|...:...:|.|              .:.:..|.|
plant   698 FLIKEGFNVSKLKPFGSSEECHALLSNGSISAAFDEVAYLRA--------------ILSQYCSKY 748

  Fly   513 AYVERYF 519
            |.||..|
plant   749 AIVEPTF 755

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ir75aNP_649012.2 Lig_chan 337..603 CDD:306551 35/198 (18%)
GLR2.8NP_001324459.1 PBP1_GABAb_receptor_plant 35..419 CDD:380645 16/59 (27%)
GluR_Plant 454..795 CDD:270404 66/364 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1052
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR18966
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.