DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir75a and Ir7f

DIOPT Version :9

Sequence 1:NP_649012.2 Gene:Ir75a / 39982 FlyBaseID:FBgn0036757 Length:629 Species:Drosophila melanogaster
Sequence 2:NP_001138177.1 Gene:Ir7f / 7354418 FlyBaseID:FBgn0259188 Length:621 Species:Drosophila melanogaster


Alignment Length:366 Identity:70/366 - (19%)
Similarity:128/366 - (34%) Gaps:107/366 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   293 ATEGRLKYL---SAIIETGFFRSVC----IFRTP---HNAGLRGDVFLQ------------PFSP 335
            ::||.::.|   :..|..|:||...    :..||   ::|.|...:.|:            ||..
  Fly   291 SSEGPIEKLLQRNVNISMGYFRKTARRNQLLTTPMSYYSANLVAVLQLERYRIGSLALLVFPFEL 355

  Fly   336 LVWYLF-----------------------GGVLSLIGVLLWITFYMECKRMQKRWRLDYLPSLLS 377
            .||.|.                       ||.|.::.:||....    .|:.:.||..::     
  Fly   356 SVWMLLLLALLIHLGIHLPSARRGNEEDGGGGLQVVALLLGAAL----ARLPRSWRHRFI----- 411

  Fly   378 TFLISFGAACIQSSSLIPRSAGGRLIYFALF--LISFIMYNYYTSVVVSSLL--------SSPVK 432
                  .|..:.:|  ||.    |:.|.:|.  ||...:|| ..|..:..||        ::..:
  Fly   412 ------AAHWLWAS--IPL----RISYQSLLFHLIRLQLYN-TPSFSLDQLLAEGFQGICTANTQ 463

  Fly   433 SKIKTMRQLAESSLTVGLEPLPFTKSYLNYSRLPEIHLFIKRKIESQTQNPELWLPAEQGV---- 493
            ..:..|.|||....::.....||....||              :.::.:|.:::..|.|.|    
  Fly   464 RLLLEMPQLARDPDSIQSVDTPFDWDVLN--------------VLTRNRNRKIFAVANQDVTLSF 514

  Fly   494 LRVRDNPGYVYVFETSSGYAYVERYFTAQEIC--DLNEVLFRPEQLFYTHLHRNSTYKELFRLRF 556
            |....:|...:|.:......|...|.......  .:::.:.|.:...:.|..|.:::..:.|   
  Fly   515 LHSSAHPNAFHVVKQPVNVEYAGMYMPKHSFLYEKMDDDIRRLDASGFIHAWRRASFASVHR--- 576

  Fly   557 LRILETGVYRKQRSYWVHMKLHCVAQNFVITVGMEYVAPLL 597
                :..|:...|.|..|.||..:   :::..|:..:|.||
  Fly   577 ----KEQVHMTSRRYINHAKLSGI---YMVMAGLYLLAGLL 610

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ir75aNP_649012.2 Lig_chan 337..603 CDD:306551 56/300 (19%)
Ir7fNP_001138177.1 Periplasmic_Binding_Protein_Type_2 231..>358 CDD:304360 14/66 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45462789
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1052
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.